Veterans Alliance is privately owned and operated to serve veterans. We are not affiliated with the Department of Veterans Affairs.

Coverage and freshness

1643 verified records across 51 states — Florida and Texas and California and New York and Pennsylvania and Illinois and Ohio and Georgia and North Carolina and Michigan and New Jersey and Virginia and Washington and Arizona and Tennessee and Massachusetts and Indiana and Missouri and Maryland and Minnesota and Wisconsin and Oklahoma and South Carolina and West Virginia and Nevada and New Mexico and Oregon and Utah and Alabama and Alaska and Arkansas and Colorado and Connecticut and Delaware and District of Columbia and Hawaii and Idaho and Iowa and Kansas and Kentucky and Louisiana and Maine and Mississippi and Montana and Nebraska and New Hampshire and North Dakota and Rhode Island and South Dakota and Vermont and Wyoming — with a page for each of their 3,144 counties.

We do not claim this is every veteran benefit in these states. We have not established a denominator by a documented method, so we report scope, method and date instead. A state not listed here has no published records, and the map says so plainly rather than implying we looked and found nothing.

1643

Published records

1643 of 1643

Verified in last 90 days

844

Records correcting an official source

598

Known gaps on the worklist

Coverage by state

Florida

67 records · 67 counties · reviewed through August 15, 2026

Florida state-level corpus after three research passes, plus a ten-record local layer.

Each record was researched against controlling authority, snapshotted, structured, and reviewed by a second person before publication.

Median record age
35 days
Verified in 90 days
67 of 67
Counties with millage held
67 of 67
Counties with local records
6 of 67
  • Statewide law: partial
  • County programmes: partial
  • City programmes: discovery
  • Districts and authorities: discovery

Texas

59 records · 254 counties · reviewed through August 17, 2026

Texas state-level source corpus plus a small local proof layer across transit and toll authorities.

Each record was researched against controlling authority — the Texas statutes, the Comptroller's property tax guidance, and the administering agency's own published terms — then structured and cross-checked against a second source before publication.

Median record age
36 days
Verified in 90 days
59 of 59
Counties with tax rate held
254 of 254
Counties with local records
6 of 254
  • Statewide law: partial
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: partial

California

34 records · 58 counties · reviewed through August 18, 2026

California state-level source corpus — property tax, education, vehicles, recreation, housing and burial.

Each record was researched against controlling authority — the California codes, the Board of Equalization’s published guidance and Letters To Assessors, and the administering department’s own terms — then structured and cross-checked against a second source before publication.

Median record age
35 days
Verified in 90 days
34 of 34
Counties with property tax rate held
58 of 58
Counties with local records
1 of 58
  • Statewide law: partial
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

New York

42 records · 62 counties · reviewed through August 18, 2026

New York state-level source corpus — the three local-option property tax exemptions, the military pension income tax exclusion, education awards, annuities, recreation and burial.

Each record was researched against controlling authority — the Real Property Tax Law, the Department of Taxation and Finance assessor manuals, and the Department of Veterans’ Services and HESC published terms — then structured and cross-checked against a second source before publication.

Median record age
30 days
Verified in 90 days
42 of 42
Counties with county levy rate held
62 of 62
Counties with local records
0 of 62
  • Statewide law: partial
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Pennsylvania

30 records · 67 counties · reviewed through August 18, 2026

Pennsylvania statewide first pass — the two records that decide the most money.

Each record was researched against the statute or regulation and the administering agency’s own published guidance.

Median record age
30 days
Verified in 90 days
30 of 30
Counties with county property tax rate held
67 of 67
Counties with local records
0 of 67
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Illinois

32 records · 102 counties · reviewed through August 18, 2026

Illinois statewide first pass — property tax and income tax.

Each record was researched against the statute and the Department of Revenue’s own published guidance.

Median record age
30 days
Verified in 90 days
32 of 32
Counties with county property tax rate held
102 of 102
Counties with local records
1 of 102
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Ohio

29 records · 88 counties · reviewed through August 18, 2026

Ohio statewide first pass — property tax and income tax.

Each record was researched against the Revised Code and the Department of Taxation’s guidance.

Median record age
30 days
Verified in 90 days
29 of 29
Counties with county property tax rate held
88 of 88
Counties with local records
1 of 88
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Georgia

31 records · 159 counties · reviewed through August 18, 2026

Georgia statewide first pass — property tax and income tax.

Each record was researched against the code and the Department of Veterans Service’s published guidance.

Median record age
30 days
Verified in 90 days
31 of 31
Counties with county property tax rate held
159 of 159
Counties with local records
0 of 159
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

North Carolina

30 records · 100 counties · reviewed through August 18, 2026

North Carolina statewide first pass — property tax and income tax.

Each record was researched against the General Statutes and the Department of Revenue’s guidance.

Median record age
30 days
Verified in 90 days
30 of 30
Counties with county property tax rate held
100 of 100
Counties with local records
0 of 100
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Michigan

32 records · 83 counties · reviewed through August 18, 2026

Michigan statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
32 of 32
Counties with county property tax rate held
83 of 83
Counties with local records
0 of 83
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

New Jersey

33 records · 21 counties · reviewed through August 18, 2026

New Jersey statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
33 of 33
Counties with county property tax rate held
21 of 21
Counties with local records
0 of 21
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Virginia

37 records · 133 counties · reviewed through August 18, 2026

Virginia statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
37 of 37
Counties with county property tax rate held
133 of 133
Counties with local records
0 of 133
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Washington

39 records · 39 counties · reviewed through August 18, 2026

Washington statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
39 of 39
Counties with county property tax rate held
39 of 39
Counties with local records
0 of 39
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Arizona

35 records · 15 counties · reviewed through August 18, 2026

Arizona statewide — property tax, income tax and the tuition waiver.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
35 of 35
Counties with county property tax rate held
15 of 15
Counties with local records
0 of 15
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Tennessee

27 records · 95 counties · reviewed through August 18, 2026

Tennessee statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
27 of 27
Counties with county property tax rate held
95 of 95
Counties with local records
0 of 95
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Massachusetts

35 records · 14 counties · reviewed through August 18, 2026

Massachusetts statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
35 of 35
Counties with county property tax rate held
14 of 14
Counties with local records
0 of 14
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Indiana

19 records · 92 counties · reviewed through August 18, 2026

Indiana statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
26 days
Verified in 90 days
19 of 19
Counties with county property tax rate held
92 of 92
Counties with local records
1 of 92
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Missouri

22 records · 115 counties · reviewed through August 18, 2026

Missouri statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
26 days
Verified in 90 days
22 of 22
Counties with county property tax rate held
115 of 115
Counties with local records
1 of 115
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Maryland

28 records · 24 counties · reviewed through August 18, 2026

Maryland statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
28 of 28
Counties with county property tax rate held
24 of 24
Counties with local records
0 of 24
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Minnesota

38 records · 87 counties · reviewed through August 19, 2026

Minnesota statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
38 of 38
Counties with county property tax rate held
87 of 87
Counties with local records
0 of 87
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Wisconsin

31 records · 72 counties · reviewed through August 19, 2026

Wisconsin statewide first pass — property tax and income tax.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
26 days
Verified in 90 days
31 of 31
Counties with county property tax rate held
72 of 72
Counties with local records
0 of 72
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Oklahoma

30 records · 77 counties · reviewed through August 19, 2026

Oklahoma statewide first pass — the homestead exemption and the sales tax card.

Each record was researched against the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
30 of 30
Counties with county property tax rate held
77 of 77
Counties with local records
0 of 77
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

South Carolina

32 records · 46 counties · reviewed through August 19, 2026

South Carolina statewide first pass — the total property tax exemption.

Each record was researched against the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
32 of 32
Counties with county property tax rate held
46 of 46
Counties with local records
0 of 46
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

West Virginia

34 records · 55 counties · reviewed through August 19, 2026

West Virginia statewide first pass — the refundable property tax credit.

Each record was researched against the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
34 of 34
Counties with county property tax rate held
55 of 55
Counties with local records
0 of 55
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Nevada

29 records · 17 counties · reviewed through August 19, 2026

Nevada statewide first pass — the tiered disabled veteran exemption.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
29 of 29
Counties with county property tax rate held
17 of 17
Counties with local records
1 of 17
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

New Mexico

33 records · 33 counties · reviewed through August 19, 2026

New Mexico statewide first pass — both 2024-amended exemptions.

Each record was researched against the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
33 of 33
Counties with county property tax rate held
33 of 33
Counties with local records
0 of 33
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Oregon

29 records · 36 counties · reviewed through August 19, 2026

Oregon statewide first pass — the escalating disabled veteran exemption.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
29 of 29
Counties with county property tax rate held
36 of 36
Counties with local records
1 of 36
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Utah

32 records · 29 counties · reviewed through August 19, 2026

Utah statewide first pass — the proportional armed forces exemption.

Each record was researched against the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
32 of 32
Counties with county property tax rate held
29 of 29
Counties with local records
0 of 29
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Alabama

39 records · 67 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
39 of 39
Counties with county property tax rate held
67 of 67
Counties with local records
0 of 67
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Alaska

28 records · 30 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
28 of 28
Counties with county property tax rate held
26 of 30
Counties with local records
0 of 30
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Arkansas

27 records · 75 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
27 of 27
Counties with county property tax rate held
75 of 75
Counties with local records
0 of 75
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Colorado

31 records · 64 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
31 of 31
Counties with county property tax rate held
64 of 64
Counties with local records
1 of 64
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Connecticut

41 records · 9 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
26 days
Verified in 90 days
41 of 41
Counties with county property tax rate held
9 of 9
Counties with local records
0 of 9
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Delaware

29 records · 3 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
29 of 29
Counties with county property tax rate held
3 of 3
Counties with local records
0 of 3
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

District of Columbia

22 records · 1 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
22 of 22
Counties with county property tax rate held
1 of 1
Counties with local records
0 of 1
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Hawaii

29 records · 5 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
29 of 29
Counties with county property tax rate held
4 of 5
Counties with local records
1 of 5
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Idaho

20 records · 44 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
20 of 20
Counties with county property tax rate held
44 of 44
Counties with local records
0 of 44
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Iowa

39 records · 99 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
39 of 39
Counties with county property tax rate held
99 of 99
Counties with local records
0 of 99
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Kansas

35 records · 105 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
35 of 35
Counties with county property tax rate held
105 of 105
Counties with local records
1 of 105
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Kentucky

32 records · 120 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
32 of 32
Counties with county property tax rate held
120 of 120
Counties with local records
0 of 120
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Louisiana

26 records · 64 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
26 of 26
Counties with county property tax rate held
64 of 64
Counties with local records
0 of 64
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Maine

36 records · 16 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
36 of 36
Counties with county property tax rate held
16 of 16
Counties with local records
0 of 16
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Mississippi

26 records · 82 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
26 of 26
Counties with county property tax rate held
82 of 82
Counties with local records
0 of 82
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Montana

32 records · 56 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
32 of 32
Counties with county property tax rate held
56 of 56
Counties with local records
0 of 56
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Nebraska

29 records · 93 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
29 of 29
Counties with county property tax rate held
93 of 93
Counties with local records
0 of 93
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

New Hampshire

31 records · 10 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
31 of 31
Counties with county property tax rate held
10 of 10
Counties with local records
0 of 10
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

North Dakota

30 records · 53 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
30 of 30
Counties with county property tax rate held
53 of 53
Counties with local records
0 of 53
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Rhode Island

28 records · 5 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
28 of 28
Counties with county property tax rate held
5 of 5
Counties with local records
0 of 5
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

South Dakota

26 records · 66 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
26 of 26
Counties with county property tax rate held
65 of 66
Counties with local records
0 of 66
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Vermont

29 records · 14 counties · reviewed through August 19, 2026

Vermont statewide first pass — the veterans exemption.

Researched against the statutory text as served by the legislature, with municipal confirmation; provenance stated in the record.

Median record age
30 days
Verified in 90 days
29 of 29
Counties with county property tax rate held
14 of 14
Counties with local records
0 of 14
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Wyoming

29 records · 23 counties · reviewed through August 19, 2026

Statewide first pass — the property tax relief.

Each record was researched against the statute or the administering agency's own published guidance.

Median record age
30 days
Verified in 90 days
29 of 29
Counties with county property tax rate held
23 of 23
Counties with local records
0 of 23
  • Statewide law: discovery
  • County programmes: discovery
  • City programmes: discovery
  • Districts and authorities: discovery

Review schedule

TierWhat is in itChange checkFull re-verifyFLTXCANYPAILOHGANCMINJVAWAAZTNMAINMOMDMNWIOKSCWVNVNMORUTALAKARCOCTDEDCHIIDIAKSKYLAMEMSMTNENHNDRISDVTWY
AHigh value, high traffic, or recently changedWeeklyQuarterly20291726108969914302620711712143111142476755255761712198312824724925958610314
BModerate value, statute-backed, stableMonthlySemi-annual29221313202319222123187131419249101272016727222424253421172131910812667191216720262222162514
CLower value or informationalQuarterlyAnnual1884301130010011030200010120232534302021100100000011

The absence of a detected change is not evidence that nothing changed — pages get deleted, programs get defunded, links rot. That is what the scheduled re-verification floor is for. If a source 404s or its content changes materially, the record is marked stale and removed from matched results immediately. It fails closed, never open.

Where the states' own sources are wrong

Florida

The most-cited official secondary source in Florida contains errors that cost veterans money. We publish records specifically to correct them.

Texas

Texas law is unusually clear on the biggest question — §11.131 names individual unemployability in terms. What goes wrong in Texas is downstream of the statute, and the third pass added two more: the Tax Code uses the word "disabled" to mean Social Security disabled rather than VA rated, and every ranking of states credits Texas with not taxing military retirement when Texas taxes nobody's income at all. Aggregators publish a blanket Texas toll waiver when §372.053 makes the discount optional and the largest operator, NTTA, declined it. The Veterans Land Board is described as one discounted loan programme when a third of it carries no discount. And the military Purple Heart plate is routinely cited to §504.5115, which is a peace-officer provision.

  • Free Tolls on TxDOT-Operated Toll Roads

    Aggregators publish "free tolls in Texas for disabled veterans" without qualification. That is true on TxDOT roads and false on several of the busiest toll roads in the state. Check the operator, not the state.

  • Free Disabled Veteran "Super Combo" Package — Residents and Non-Residents Alike

    This record previously imposed a Texas residency requirement. TPWD applies none — the package goes to residents and non-residents who qualify as disabled veterans.

  • Texas Veterans Land Board Land Loan

    The VLB's own guidance says it plainly: the land loan is a State of Texas loan and is not made in conjunction with the Department of Veterans Affairs, so disability rating discounts do not apply to it. The home loan and home improvement loan do carry a 30 percent discount. Summaries that describe "VLB loans" as a single discounted programme are wrong about a third of it.

  • Texas Veterans Land Board Home Improvement Loan

    This record carried a deny rule for the VLB's 30 April 2026 moratorium on new applications. On 22 August 2026 the VLB's own programme page carried no moratorium notice and was accepting applications, with the base and discounted rates published — so the pause has been treated as lifted and the deny rule removed.

  • Purple Heart Licence Plates

    The military Purple Heart plate is §504.315(g). It is frequently mis-cited as §504.5115, which is a different plate entirely — that section covers a Purple Heart awarded by the Department of Public Safety or another Texas law enforcement agency to a peace officer wounded in the line of duty. Citing the peace-officer provision for a combat decoration is wrong even though both plates say "Purple Heart".

  • Texas State Veterans Homes — Subsidised Long-Term Nursing Care

    We published nine homes. The General Land Office now lists ten — the tenth is the Tuskegee Airmen Texas State Veterans Home at Fort Worth. The full list is Amarillo, Big Spring, Bonham, El Paso, Floresville, Fort Worth, Houston, McAllen, Temple and Tyler.

  • The Over-65 or Disabled Person Homestead Exemption

    This exemption was $10,000 for many years and we published that figure. The Comptroller now states §11.13(c) as a $60,000 additional school district exemption, and §11.13(b)’s general school exemption as $140,000. Anything written against the old numbers — including our own earlier pages — understates this by six times.

    The word "disabled" does not mean what a veteran expects it to mean here. §11.13(m) points at the federal Old-Age, Survivors, and Disability Insurance definition — Social Security disability. A VA combined rating, at any percentage including 100%, does not by itself satisfy it. Many veterans do draw SSDI and simply never connect the two.

  • Texas Does Not Tax Military Retirement — Because It Taxes No Income at All

    Almost every "best states for veterans" ranking credits Texas with not taxing military retirement pay, alongside genuine benefits, as though it were something the state does for veterans. It is not. Article VIII, §24-a of the Texas Constitution — amended by Proposition 4 in November 2019 to a flat prohibition — forbids the legislature from taxing the net income of individuals at all.

  • Fund for Veterans' Assistance — Housing, Transport, Legal and Mental Health Help

    This is routinely written up as a fund a veteran can apply to. It is not. The Commission states plainly that it does not award funding directly to individuals or families. A veteran who tries to apply to the state loses the time it takes to be told so, which is time they usually do not have.

  • Parklands Passport — Every Honorably Discharged Veteran

    The existing coverage — ours included — led with the disabled-veteran passport. The statute reaches EVERY honorably discharged veteran, and separately the Gold Star family members, which is what the August 2026 audit flagged as the miss.

  • Gold Star Plate — Foster and Step Relations Count, and the Fee Subsection Is Gone

    The statute sets no remarriage condition. A surviving spouse who remarried is not disqualified by anything in the section as it now reads.

  • Ask for the Access Symbol on the Plate — the DV Plate Alone Will Not Park You

    The widespread belief that a Disabled Veteran plate is an all-purpose accessible-parking credential does not survive §681.006. That section names the §504.201 disability plates and the placard, and nothing else. The meter exemption at §681.008 is a separate right and is not evidence of a reserved-space right.

  • NTTA Charges Veterans in Full — There Is No Discount on Its Roads

    Aggregators publish "free tolls in Texas for disabled veterans" without naming an operator. On NTTA roads — the Dallas North Tollway, the President George Bush Turnpike, SH 121 — it is false. NTTA states that it receives no state appropriation to fund a veteran toll programme and that its agreements with bondholders require it to collect tolls to repay the debt. We publish this record for the same reason the Florida corpus publishes a record saying Florida has no disabled-veteran toll exemption: a benefit that does not exist should be findable as not existing.

California

California states its rules clearly and publishes them well — the Board of Equalization prescribes the forms and republishes the indexed amounts every year. What goes wrong here is downstream: the old $4,000 Veterans' Exemption is widely listed as a live benefit when its property cap makes it unreachable for any homeowner, the College Fee Waiver is described as one programme when it is four with near-opposite conditions, and the single most valuable thing available to a long-time homeowner — the Proposition 19 base year value transfer — appears on no veteran benefits list at all, because it is a disability provision rather than a veteran one.

  • The $4,000 Veterans’ Exemption — and Why Almost Nobody Can Use It

    Benefit lists routinely present this as "California gives veterans a $4,000 property tax exemption" and stop there. The property cap of $5,000 single or $10,000 married makes it unreachable for any homeowner, and its qualifying wars are mostly conflicts that ended before 1900. We publish the record so that a veteran who has read about it can find out why their assessor said no.

  • Free Tolls Statewide on a Veteran Licence Plate

    The exemption is NOT automatic on the plate. §23301.3(b)(3) makes an enrolled transponder account a condition of the exemption, and enrolment is with each tolling agency separately. A veteran who reads "free tolls for veteran plates" and drives an unenrolled vehicle through a gantry is billed like anyone else.

  • Exclude Up to $20,000 of Military Retirement Pay from California Income Tax

    California is still widely described as giving military retirees no relief at all. That was correct until the 2025 tax year and is now wrong. It is also wrong in the other direction to describe the exclusion as making military retirement tax-free here: the base rule in FTB Publication 1032 is unchanged — military retirement pay is taxable by California when received by a resident — and this is a capped carve-out from it.

  • Gold Star Family Plate — Eleven Relationships Qualify, and Renewal Is Free

    The qualifying-death list is narrower than "died on active duty". It is four defined circumstances — wartime, a recognised international terrorist attack, operations outside the country, or a United Nations-authorised peacekeeping force. A line-of-duty death at a domestic post does not obviously sit inside any of them.

  • The Disabled Veteran Plate Parks Free — No Placard Required

    Elsewhere in this corpus the disabled veteran plate and the parking privilege are deliberately separated, and the veteran has to get a clinician to sign a second form. Here they are the same thing. A veteran arriving from a state that separates them will be paying meters they do not owe.

  • Defer the Utility Bill on Call-Up — Up to 180 Days

    This is a deferral, not forgiveness and not a discount. The bill is still owed; what changes is when. A household treating it as relief rather than as a delay will meet the whole amount at the end of the period.

  • The Aging Department Runs No Veteran Caregiver Programme

    Federal caregiver programmes get filed under state headings constantly. The distinction is not pedantic: the eligibility rules, the stipend and the appeal route are all federal, and no state office can move any of them.

New York

New York publishes its rules well; what goes wrong is the gap between the statute and any national summary of it. Every guide gives a single figure for "the New York veterans exemption" when the statute sets only a BASIC maximum that each locality may adopt, vary or decline — and then multiplies it by that locality's equalization rate. Almost nothing lists the military pension income tax exclusion, which for a retiree is usually worth more than all three property exemptions together. And the Gold Star parent extension is adopted separately again, which even assessors' own front desks answer about wrongly.

Pennsylvania

A first pass over Pennsylvania statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Total Real Estate Tax Exemption — For Disabled Veterans and Their Surviving Spouses

    The financial need test is not the barrier it is described as. An annual income of $114,637 or less carries a presumption of need. Above that, need is still found where allowable monthly expenses exceed monthly household income — and the potential real estate tax liability is itself counted as an expense in that comparison.

  • Pennsylvania Does Not Tax Your Pension — But It Does Tax Duty Pay Earned In-State

    Pennsylvania is often listed as simply "does not tax military pay". The in-state exception is real and is missed: income received by a Pennsylvania resident for military service performed INSIDE Pennsylvania is fully taxable, even on federal active duty, unless it is active duty within the state for an emergency.

  • Hunting Licence — Free, or a Dollar, or for Life

    Three tiers, not one. Pennsylvania is usually written up as giving free hunting licences to disabled veterans, which is true only at the top. At 60–99% the licence costs a dollar, and a veteran told "free for disabled veterans" often concludes they do not qualify at all.

  • Free Vehicle Registration for Severely Disabled Veterans

    PennDOT states plainly that licence plate fees still apply. "Free registration" is exactly that and no more, and a veteran expecting a free plate is told otherwise at the counter.

  • Military Family Relief Assistance — Grants to $5,000

    The maximum is now $5,000. The programme began at $2,500 and moved to $3,500 in 2010, and summaries still carry both old figures. The DMVA application page states up to $5,000, as a grant, with no repayment.

  • Fishing Licence — Free for Life, or a Dollar

    The fishing tiers are NOT the hunting tiers. The hunting licence in this corpus is a dollar at 60–99% or for a wartime disability; the fishing licence is free only at 100%, and its dollar tier is 60–99% or former prisoner of war. Assuming the two commissions run the same rule gets both wrong.

  • Military and Veterans’ Licensure — Six Provisions, Not One

    The fee waiver is not a veterans’ benefit in Pennsylvania. It is for a military spouse relocating on orders. A veteran expecting a waived application fee here will be disappointed — what they get is speed and credit for experience.

  • Veteran Business Enterprise Verification for Commonwealth Contracting

    Pennsylvania does not run its own veteran business certification. It verifies a certificate issued elsewhere, so a veteran who starts with the Commonwealth is starting in the wrong place — VetCert or Disability:IN comes first.

  • Birth and Death Certificates Free — Ten Copies a Year

    A free certificate ordered online is not free. The Department waives the $20 certificate fee and states the waiver does not cover the online service fee, which is an additional $10. Order by post or in person and the whole cost goes away.

  • Burial Honours — and No State Veterans Cemetery

    The stipend in this programme is not money for the family. DMVA pays it to the veterans organisations that provide burial honours. A survivor who applies expecting a burial allowance has misread the programme.

    Pennsylvania operates no state veterans cemetery. The Department names three national cemeteries and no Commonwealth site, so the gravesite, headstone, flag and Presidential Memorial Certificate all come from the federal system.

  • Operation Recognition — A High School Diploma for Service Interrupted

    The State does not issue this diploma. Your local board of school directors does. A veteran writing to Harrisburg will be redirected, and the district is the only body that can act.

  • Fairweather Lodges for Veterans — Permanent Shared Housing With Work

    This is permanent housing, not a transitional programme with an exit date. That is the point of the Fairweather model, and it is a different proposition from the two-year transitional programmes veterans are usually offered.

  • Up to $750 Towards a Burial or Cremation — and the VA Money Comes Off It

    DMVA lists this under state veterans programmes, which invites a veteran’s family to read it as a veterans’ burial allowance. It is not one. Nothing in Chapter 283 mentions service, and a veteran who was never on assistance is outside it entirely.

    The federal VA death benefit does not stack with this payment — it is deducted from it under §283.22(b). Planning on both is planning on money that will not arrive.

  • Pension Poaching — Nobody May Charge You to File for a VA Pension

    Paying someone to prepare a VA claim is not a shortcut to a faster decision. DMVA’s own list of things a veteran should never pay for includes the submission of the application itself, which is exactly what the paid services sell.

  • A Veterans Court Instead of the Ordinary Docket — In 26 Counties

    This is not a state-wide right. Twenty-six of sixty-seven counties have a programme, so a veteran in the wrong county has no veterans court to be diverted into however well they fit the description.

  • Women Veterans — a Committee and a Field Network, Not a Separate Benefit

    A published absence, not an oversight. We read the department’s own women veterans page end to end: every substantive health, housing and trauma resource it names is federal, and the state provision is committee work, outreach and grants to third parties.

Illinois

A first pass over Illinois statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Veterans' Preference in State Employment

    The ten-point tier sets NO percentage threshold. The rule asks only that the veteran currently hold proof of a service-connected disability from the VA, so a rating of 0% with a letter to show for it reaches the ten points just as a high rating does. Our question asks for a combined rating and cannot tell a 0% service-connected veteran apart from a veteran with no service connection at all, so if you hold a 0% award letter, claim the ten points regardless of what this page returns.

    The lowest tier has no war gate and no disability gate — an honourable discharge and at least six months of service earns three points. A veteran who has read a wartime-only rule in another state will assume they are excluded and claim nothing.

  • Disabled Veteran Plates — Registration Free

    The physician certification is not a mobility test bolted onto a rating threshold. What the Department of Veterans Affairs publishes is proof of service connection from the VA plus a licensed physician certifying that the disability qualifies the veteran for a disabled placard or plate — with no rating percentage anywhere in it. A veteran rated below 50% who was told the plate needs a high rating was told wrong.

  • Military Training Toward a Licence — Medic to Nurse Aide, and a Degree Waived for Police and Fire

    The thirty-day expedited review is a transition benefit, not a veteran benefit. It reaches an active-duty member, a member whose active duty ended within the preceding two years, and their spouses. A veteran ten years out of service is outside it — but the military training equivalences above have no such window.

  • The State Veterans Homes — a $1,659 Ceiling on What You Contribute

    The contribution ceiling is the fact worth carrying away. Long-term care in this state runs many times $1,659 a month, and the cap is worked from income alone — assets are expressly excluded. A veteran who assumed a state home would take their savings has the arithmetic backwards.

  • Veteran-Owned Business Certification — a 3% Share of State Procurement

    Read the 3% as a target agencies are measured against, not as a set-aside you can claim. Neither administering page read this session describes a formal set-aside or a bid price preference — what certification buys is being counted, being findable, and being sought out by buyers under pressure to hit the number.

  • The War Participation Bonus — $100 a War, and $50 a Month for a Prisoner of War

    The Second World War bonus is the only one on a monthly scale — $10 a month domestic, $15 a month foreign, with a minimum of sixty days of active duty. Treating it as a flat $100 like the others understates it substantially for a long war record.

  • The County Veterans Assistance Commission — Rent, Utilities and Food, Paid by Voucher to the Vendor

    This is not a state programme with county offices. Each commission is its own body with its own funding and its own rules, so the figures in this record are the ones published by the single commission that could be read this session. Treat them as a worked example of the shape, not as your county's numbers.

  • The Guard Grant — Tuition and the Fees Nobody Else Covers

    The one-year qualifying period is state Guard service. A member who transferred in after years in another branch starts that clock at the transfer, which is a surprise worth having early rather than at enrolment.

  • The $125 Nobody Claims — Setting a Federal Headstone

    This does not apply where the burial is in a national or state veterans cemetery — those set the marker as part of the interment. It is a private-cemetery benefit in practice.

  • $3,000 for a Survivor of a Hostile-Action Death

    The state runs several payments with confusingly similar names and wildly different amounts: $100 bonuses for service, $50 a month for captivity, $1,000 for two specific historical death categories, and this $3,000. A family that finds one of them frequently stops looking.

  • The Warmline — 24 Hours, Confidential, and It Is Not a Crisis Line

    Caregivers and family members are named as served. Households repeatedly assume the line is for the veteran only and go without support the state is already funding.

  • The State Veterans Cemetery at Quincy — and It Has Been There Since the Civil War

    Guides that say this state has no state veterans cemetery are wrong. It has one, at Quincy, and it is older than most of the federal ones. What it does not have is a published eligibility page, which is why it disappears from summaries.

  • Roughly $347,904 to the Next of Kin — and It Is Not the Veterans Department That Pays It

    It is limited to deaths in the line of duty in support of the Global War on Terrorism as the department describes it. A family of a service member who died in another period should still ask the Court of Claims what applies to them rather than assuming nothing does.

  • $5,000 Off Your Assessment for Coming Home — No Rating Needed, and the Window Is Two Years

    It is not permanent and it is not a credit off the bill. It reduces the equalised assessed value by $5,000 for two assessment years, and what that saves you depends entirely on your local rate.

  • Veterans Court — Certified by the Supreme Court, and in 21 Named Counties

    Guidance widely states that a veterans treatment court was mandated in every judicial circuit. Whatever the statute says, the judicial branch’s own published map lists veterans courts in 21 counties. Check the map for the county your case is in rather than assuming coverage.

  • CTA Rides Free From 10% — the Military Service Pass

    Summaries file free CTA rides under "disabled veterans" as if a high rating were needed. The stated gate is compensation at 10% or greater — the lowest free-transit threshold we have verified anywhere — and the sharp edge is elsewhere: military retirees without a service-connected disability are excluded.

Ohio

A first pass over Ohio statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Veterans' Examination Credit

    This is a PROPORTIONAL credit, not points. Twenty per cent of the total grade is worth several times the five or ten points other states add, and a veteran who reads "veterans preference" and pictures a few points will undervalue it badly.

    There is no larger credit for a disabled veteran. Every other state in this corpus has a disability tier; Ohio does not, and the twenty per cent applies regardless of rating.

  • No-Fee Temporary Licence for Servicemembers and Their Spouses

    Ohio Rev. Code §5903.10 is often described as extending a licence through deployment. It does not. It lets a licence that expired during active service be renewed at the usual cost without penalty or re-examination — the board’s own page says in terms that this "does not extend the expiration date of a license." If your posting requires a live licence, renew before you go; boards will arrange an early renewal if you ask.

  • Ohio Veterans Homes — Wartime Service and a Disabling Condition

    Spouse admission is the detail that catches families out. Several state veterans homes admit a resident’s husband or wife alongside them. Ohio does not: the department’s own answer is that an admittee’s spouse may be admitted "only if he or she is a veteran who meets all of the eligibility requirements." A non-veteran spouse cannot move in.

  • Veteran-Friendly Business Enterprise — 5% Bid Preference

    This is not a veteran-owned business certification and calling it one costs firms the award. The first eligibility route asks only that at least 10% of employees are veterans or on active service. A company with no veteran owner at all can hold the certificate; a veteran-owned firm with no other veteran staff still qualifies on the 51%-ownership route. Read which route you are on before you certify.

  • County Veterans Service Commission Financial Assistance

    This is not a state programme with one set of rules. It is 88 county programmes under one statutory frame, funded by county property tax. A figure quoted to you from another county is not a promise about yours, and the reverse is also true — do not rule yourself out on a neighbouring county’s limits.

    The commissions are not only for the veteran. Montgomery County lists active-duty members, spouses, widows and widowers, dependent parents drawing VA compensation and qualifying minor children among those who may apply on the veteran’s service.

  • Military Injury Relief Fund — $500, Up to Three Times, and PTSD Counts

    A veteran with no medal for it is not shut out. The brochure’s third documentation route exists precisely for traumatic brain injury, blast injury and PTSD, and asks for a medical diagnosis rather than a decoration.

    This is not a once-in-a-lifetime payment any more. Since the February 2023 rule change it can be claimed up to three times, one grant per state fiscal year.

  • Ohio Veterans Bonus — Closed. Applications Ended 30 August 2024

    Third-party benefit guides published in 2026 still list the Ohio Veterans Bonus as an available state benefit. The department that ran it says otherwise on the page where you would have applied.

  • Burial in Ohio — There Is No State Veterans Cemetery, and the Department Points to National Ones

    Ohio Western Reserve and Dayton are national cemeteries run by the federal government, not state veterans cemeteries. Being buried in one is a federal benefit that happens to be located in Ohio.

  • Indigent Veteran Burial or Cremation — Paid by the County, Capped by the County

    There is no Ohio indigent burial figure. Guides that quote one are quoting a county. The commission in the county where the veteran lived sets the ceiling, and the only published maximum we read this session was $500.

    It is not only for the veteran. The Attorney General describes the expenses as incurred for indigent veterans and their family members, so a veteran’s spouse or surviving spouse is inside the programme rather than outside it.

  • Ohio’s 6% Interest Cap on Deployment — Wider Than the Federal One, and It Covers the Spouse

    The commonly repeated line is that the 6% cap only reaches debt you already had when you were called up. That is the federal rule. The Ohio judiciary’s own bench aid says Ohio law does not limit coverage to pre-service loans.

  • Ending a Mobile Phone Contract or a Vehicle Lease on Deployment — Ohio Asks Less Than the Federal Rule Does

    A carrier that says the plan has to be unsupported at your destination is describing the federal provision. The bench aid describes the Ohio one as turning on deployment on active duty and nothing more.

    A vehicle lessor that says the move has to be overseas is describing the federal provision. The bench aid states that Ohio law does not require the deployment to be outside the continental United States.

  • The Patriot Plan — No Gas or Electric Disconnection While Deployed, and Deployment-Length Time to Catch Up

    This is not a discount and it is not means-tested. It is a timing and fees protection on a utility account, and a household well above any income limit is inside it.

    The name oversells the reach. The regulator’s own wording is "any military reservist or National Guardsman deployed on active duty", and it says the plan does not apply to career active-duty personnel serving their regular tour of duty. This is a Guard and reserve protection in substance, aimed at the person called away from a civilian life.

  • PIPP Plus — a Gas and Electric Bill Set at 5% or 10% of Household Income

    There is no veteran version of this and no veteran discount bolted onto it. The consumers’ counsel fact sheet sets eligibility on household income alone and does not mention veterans anywhere. A veteran below the income line uses the same plan as everyone else below it.

    The department changed on 6 April 2026. Guidance and leaflets that send you to the Ohio Department of Development for energy assistance are out of date — the Department of Job and Family Services runs these programmes now, and says there is no interruption of service and no change in the application process. Your local energy assistance provider is still the place to apply.

  • A Ride to the VA Hospital from Your County Veterans Service Commission — and the Ambulatory Rule Nobody Warns You About

    There is no Ohio veterans transportation programme with one number to ring. There are eighty-eight county veterans service commissions, each running its own van to its own list of destinations on its own notice period, under the same Title 59 duty.

  • Homegrown by Heroes for Ohio Farmer Veterans — Promoted by the State, Certified by Someone Else

    Ohio does not certify farmer veterans. The Department of Agriculture promotes a national label through its Ohio Proud programme; the certifying body is the Farmer Veteran Coalition, and the application does not go to the state. Anyone expecting a state certificate, a state fee schedule or a state appeal route will not find one.

  • Women Veterans in Ohio — an Advisory Committee, and Plates the BMV Issues Only to Women Who Served

    This record is deliberately low-weight. The Ohio women veterans offering read this session is an advisory committee, an awareness project and a licence plate — not a benefit that pays. The money routes for an Ohio woman veteran are the same ones open to every Ohio veteran.

Georgia

A first pass over Georgia statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • A Free One-Year Hunting and Fishing Licence, and a Discount if You Are Disabled

    The disability route is a DISCOUNT, not a free licence. Summaries built on the older honorary-licence language promise a permanently and totally disabled veteran free hunting and fishing; the Department of Veterans Service now publishes a discounted three-year disability sportsman’s licence instead. Only a totally blind resident is listed for a free lifetime honorary fishing licence. Budget for a fee.

    There is no one-year window from coming home. The One Time Veterans Licence is gated on a 90-day active federal duty period and an honorable discharge dated 1 July 2005 or later, and the one year is how long the licence lasts from issue — not how long you have to ask for it. A veteran discharged years ago and told the window had closed was told wrong.

  • Five or Ten Points — and the Ten Reach Spouses Too

    The ten points REPLACE the five — the statute says the preference is in lieu of and not in addition to any other similar preference. A disabled veteran scores ten, not fifteen, and guidance that lists the two preferences separately invites the wrong sum.

  • Free Veteran Plates — and the Base Plate Is Only One of Them

    This is not a disabled veteran benefit — every honorably discharged veteran takes one free plate. Summaries that file free plates under disability leave most Georgia veterans unaware they hold this.

  • Veterans Business Certificate of Exemption — Ten Years, No Local Occupation Tax

    This is not a licence fee discount. It is an exemption from the local occupation tax and from the administrative and regulatory fees a city or county charges to trade there — the recurring cost of being in business, removed for ten years. A veteran who reads "certificate of exemption" as a licensing thing and files it with a state board will get nowhere; it goes to the probate court.

  • Georgia War Veterans Homes — Two Residency Routes, VA Pays at 70%

    The Cold War era on this list runs 31 January 1955 to 1 August 1990 and counts. Read together with the open-ended Persian Gulf period from 2 August 1990, almost any post-1955 service falls inside a qualifying period — a veteran told they are "not a wartime veteran" for these homes should read the dates before accepting it.

  • Expedited Licence for Military Spouses — and the Compact Trap

    Expedited is not free. The rule requires that the applicant "has paid the required fee" both for endorsement and for expedited processing. Guides that list this among fee waivers are wrong about it.

    The compact exclusion removes the professions military spouses most often hold. If Georgia is in the compact for your profession and your licence is from another compact state, you are outside this route — nursing, psychology, counseling, speech-language pathology, physical therapy and occupational therapy are named on the state’s own list.

  • Veterans Memorial Cemeteries — No Charge, Vault Included, Spouse Included

    The vault is included. Families are routinely quoted a vault as a separate and substantial line item by funeral homes; the department lists it among the things it does not charge for.

    The no-charge wording is not confined to the veteran. The department writes it as covering an eligible veteran or spouse or eligible family member in the same breath, which is not how most state cemeteries handle the family side.

  • Free Driver’s Licence — for the Veteran, for a Spouse Who Drives for Them, and for the Guard

    A medical discharge is inside this, and it is easy to miss. The Department of Veterans Service names an honorable discharge or a medical discharge as the two routes to a free veteran licence.

    The honorary spouse licence is not for every spouse. It is for the spouse of a veteran whose disabilities preclude operating a motor vehicle — the point is that someone in the household still has to be able to drive — and separately for an un-remarried surviving spouse.

  • National Guard Service-Cancelable Loan — a Loan That Service Pays Off

    The headline "up to 100% of tuition" is not what the commission publishes. What it publishes is a per-credit-hour rate that varies by institution, so whether it covers your tuition depends entirely on where you enrol.

  • Free Birth, Death, Marriage and Divorce Records for a Federal Claim

    The vital records fee page and the veterans department describe two different worlds. The fee page quotes $25 to everyone; the veterans department says the same records are free for a disability or death claim. Both were read this session, and the applicant has to bridge the gap by asking.

  • Military Funeral Honors — Rendered by the Georgia National Guard, Often on 24 Hours’ Notice

    A missing DD Form 214 is not a reason to wait. The programme states plainly that a request may be submitted without proof of service and that it will obtain the information afterwards — which matters, because the paperwork usually surfaces days after the funeral.

  • Breaking a Lease on Orders — Six Routes Out, and a Cap That Covers Your Family

    This is wider than the federal rule most people have heard of. The federal Servicemembers Civil Relief Act is built around entry into service and a permanent change of station or a deployment of 90 days or more. Georgia adds routes the federal rule does not carry — being ordered into government quarters, and becoming eligible for quarters where staying out costs you the housing allowance.

    The family section is the one that gets missed. O.C.G.A. §44-7-37 is a separate provision from §44-7-22 and it protects the person left behind in the property rather than the service member. Cite it by number, because a leasing office asked about "the military clause" will look at the wrong section.

  • Cancelling the Contracts You Cannot Use — Phone, Gym, Television and Internet

    The gym membership is inside this and it is the one people keep paying. A health spa membership was added by the 2019 change alongside television and internet — a service member who cancels the phone and leaves the gym direct debit running is leaving money on the table for the whole deployment.

  • What a Creditor Cannot Take — VA Compensation, Military Retired Pay and Survivor Annuities

    Exempt does not mean untouchable in practice. A bank served with a garnishment will commonly freeze the account first and sort out the exemption afterwards, so the protection is only as good as the claim you file — and the proof that the frozen money is the exempt money.

    The payday lender entry is a Georgia rule and it reaches the spouse. O.C.G.A. §16-17-9 exempts wages earned by members of the United States military or their spouses in connection with payday lenders — ordinary earned wages, not benefits, and only against that class of creditor.

  • Utility Bill Discounts — There Is No Veteran Route, and That Is Worth Knowing

    This is a published absence, not a gap in our research. Three official pages that each enumerate the qualifying routes were read this session, and a veteran route is on none of them. We carry it at weight_hint 0 so it never counts as a benefit.

  • Full-Service Fuel at the Self-Service Price

    The passenger test is the part that surprises people. The duty falls away where someone 16 or over and not disabled is in the car with you — so a veteran travelling with an adult companion is outside it, however hard pumping fuel actually is for them.

  • Veterans Court Division — Dismissal Is on the Table, but Only Before Judgment

    The moment of referral decides what completion is worth. Referred before the entry of judgment, completion can end the case entirely. Referred as part of a sentence, the best it does is reduce or modify that sentence. Both are called "veterans court", and the difference is not usually explained.

  • Women Veterans Office — Claims Help, Military Sexual Trauma Counselling, and Court Mentors

    This is not an outreach-and-events office. The department’s own description puts claims filing and military sexual trauma counselling first, which makes it a service door rather than a networking one.

North Carolina

A first pass over North Carolina statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Military Retirement Pay Deducted in Full — After Twenty Years

    North Carolina is widely listed as simply exempting military retirement. The twenty-year service requirement is real and is the reason some retirees are refused. A medical retirement under 10 U.S.C. chapter 61 is the alternative, and a Survivor Benefit Plan beneficiary of an eligible member qualifies in their own right.

  • Lifetime Hunting and Fishing Licence for $15, at 50%

    This licence is cheap, not free. The record previously carried it as a waived fee. The Commission's own application prices the hunting and inland fishing combination at $15, with a $5 transaction fee on top set by N.C.G.S. §113-270.1B — and the full Sportsman licence at $131. For a lifetime licence $20 is still an extraordinary price, but a veteran who turns up expecting to pay nothing will be asked for money.

    The lifetime is conditional. The Commission's wording is that the licence remains valid for the lifetime of the individual "so long as the individual remains fifty percent or more disabled" — so a rating reduced below 50% takes the licence with it. Every summary we have seen calls it simply a lifetime licence.

  • Veterans Employment Preference

    Subsection (c) speaks of service during a period of war, and that is how this is usually summarised. The definition of an eligible veteran in (b)(3) also reaches a veteran who suffered a disabling injury for service-related reasons during PEACETIME, that veteran’s spouse, and the surviving spouse or dependant of someone who died for service-related reasons in peacetime.

  • Disabled Veteran Plate — One Free Plate Every Year

    Individual unemployability counts. This record previously gated the free plate on a combined rating of 100% alone. The certifying department publishes the gate as a combined rating of 100% OR individual unemployability paid at the 100% rate — so a veteran rated 70% but paid at the 100% rate on unemployability is on the free list, and would have been turned away by the old rule.

    The Purple Heart plate is NOT free. This record used to say it sat in the same free-of-charge list as the disabled veteran and ex-prisoner of war plates. The application form puts it under "License Plates Which Require No Additional Fee" — meaning it costs no more than an ordinary plate, not that it costs nothing. The free block holds the disabled veteran plate, the disabled veteran motorcycle plate, ex-prisoner of war, Bronze Star with combat device, the Medal of Honor, the Distinguished Service Cross, Legion of Valor and the Silver Star.

  • No Initial Application Fee for Military-Trained Applicants and Military Spouses

    The fee bar is the part that gets dropped. Subsection (k) says a licensing board "shall not charge a military-trained applicant or a military spouse an initial application fee" — and it reaches the temporary practice permit too. Summaries that describe this statute purely as training-credit understate it by the whole cost of applying.

  • State Veterans Cemeteries — Free for the Veteran, a Fee for the Family

    The word "free" attaches to the veteran, not to the family. The division says plainly that there is a burial fee for an eligible spouse or family member. Get the figure from the cemetery before you plan around it.

  • North Carolina Tuition Assistance Program — Up to $3,240 a Semester, Reimbursed

    Fees are not covered everywhere. The information paper approves 100% of tuition and fees only at North Carolina community colleges and the NC Promise schools; at every other institution NCTAP pays tuition and leaves the fees with you.

    Full Post-9/11 GI Bill entitlement makes a member ineligible rather than topping up. NCTAP is written as the payer that adjusts around federal money, not as an addition to it.

  • Free Recording of a Military Discharge — and It Is Not a Public Record

    This is not something to post in. The register of deeds states the discharge must be filed in person by the authorised party, which is the commonest wasted attempt at this benefit.

  • Military Leave for State Employees — 120 Paid Hours, Then 30 Days’ Pay, Then Differential

    It is 120 hours, not 15 days. For anyone whose shifts are not eight hours long, converting the allowance to days gives the wrong answer in both directions.

  • State Veterans Homes — Four Skilled Nursing Facilities Run by the State

    Five homes are still listed and only four are operating. Fayetteville is closed for structural reasons, so a family working from an older list will call a building that cannot admit anyone.

  • Burying a Spouse or Child at a State Veterans Cemetery — the Fee You Cannot Pre-Pay

    A North Carolina driving licence will not prove residency here. The department’s own brochure excludes it by name and asks for two documents from a specific list instead — voter registration, a jury duty form, a concealed carry permit, state income or property tax records, a W-2 showing North Carolina tax paid, or the deed to the home.

    The dependant burial fee cannot be pre-paid, and the department will not quote it as a fixed figure. A family trying to settle the cost in advance is asking for something the cemetery says it does not offer.

  • Cancel Your Phone, Internet, TV and Gym Contracts on Relocation Orders — No Early Termination Charge

    This is not the federal SCRA’s telephone-service provision. North Carolina’s section is wider — internet, television, satellite radio and prepaid entertainment contracts are named alongside telecommunications — and it bans the early termination charge outright rather than leaving it to negotiation.

  • A Stay of Civil Proceedings, a Lease Extension for State Active Duty, and a $5,000 Penalty Behind Them

    §127B-32 is an extension, not an escape. It helps a Guard member whose lease runs out mid-deployment; it does nothing for someone who wants out of a lease early. Confusing the two is the commonest way this section is misread.

  • The State Early Lease Termination Right — Narrowed in 2019, and Probably Not Yours

    The two agency sources read this session do not agree, and that disagreement is the point of this record. The Real Estate Commission bulletin describes N.C.G.S. §42-45 as reaching military personnel generally; the State Bar’s military legal assistance article says the 2019 Act narrowed it to military technicians. Anyone about to serve notice should treat the state route as unsettled and take advice first.

    The liquidated damages ladder — one month’s rent, half a month’s rent, nothing after nine months — is the state statute’s. Under the federal route the State Bar article states no liquidated damages or penalties are imposed on the tenant at all, so a landlord quoting the ladder may be quoting a rule that no longer applies to you.

  • Called Up by the Governor — Unpaid Leave, and Nobody Can Make You Burn Your Holiday

    This is unpaid leave, not paid leave. Its worth is that your accrued holiday is protected from being spent on a state call-up — an employer cannot substitute vacation for it.

  • No Veteran Utility Discount in North Carolina — Apply on Income Instead

    Utility discounts are one of the most commonly assumed state veteran benefits, and in North Carolina the assumption does not hold at state level. Nothing read this session gives a veteran a rate, a credit or a place in the queue that a non-veteran on the same income would not have.

  • State Contracting — the HUB Office Was Abolished in July 2026 and Nothing Veteran-Specific Replaced It

    Fifty-state certification directories still list North Carolina as offering a route for veteran-owned and disabled-owned businesses through the HUB office. That office was abolished by the 2026 state budget and its certifications stopped being recognised by state government contracts on 7 July 2026.

Michigan

A first pass over Michigan statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

New Jersey

A first pass over New Jersey statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • The $6,000 Veteran Income Tax Exemption

    This is often described as a military pension exclusion. It is not. It is a flat personal exemption for having been honorably discharged, available whatever your income source, and it does NOT pass through to a surviving spouse.

  • Free Hunting and Fishing Licences

    There is no percentage threshold. A service-connected disability of any degree qualifies — which makes New Jersey the widest recreation entitlement in this corpus. A veteran rated 10% who has read another state’s 100% rule will wrongly assume they are excluded.

  • Absolute Veterans Preference in Civil Service

    The preference is wartime-defined. Qualifying service during a listed conflict window is required, or a service-incurred injury during one regardless of length of service — peacetime-only service does not carry it. A veteran told "New Jersey has absolute preference" without that qualifier will overestimate their claim.

    The filing deadline is later than this record used to say. It previously said the claim had to be filed before the examination closing date. The veterans department publishes something more generous: the preference can be established as late as 8 days before the open competitive employment list is issued. A veteran who thought the door had shut at the closing date may still be in time.

    Reserve and Guard training does not count towards the active duty requirement. Basic training, advanced training, officer candidate school, weekend drills and annual training are all excluded by name, whatever the era. A reservist counting those days towards the 90 or the 14 will come up short.

  • Disabled Vet Plates and Placard — 24-Hour Meter Exemption, Any Rating

    Secondary summaries report free plates or free registration for 100% disabled veterans here. The Motor Vehicle Commission publishes neither. Its own plate list prices the Disabled Vet plate at $15, on top of the ordinary registration fees, and its free-registration classes turn on adaptive equipment or war blindness rather than on any rating percentage.

    Free registration is not about how disabled you are. The Commission publishes two doors and a percentage opens neither: war blindness with entitlement to State compensation under N.J.S.A. 38:18-1, or having qualified for a free automobile from the VA and driving a vehicle fitted with the special attachments needed to operate it safely. A veteran rated 100% with an ordinary car does not qualify — and one rated far lower, driving an adapted vehicle, may.

  • Burial at the Brigadier General William C. Doyle Veterans Memorial Cemetery

    A pre-registration is not a reservation. The department says so directly, and a family that has planned around a specific plot on the strength of one will be disappointed at the worst possible moment.

  • New Jersey National Guard Free Tuition — 16 Credits a Semester

    Graduate study is inside this benefit, not outside it. The Department’s own wording is "undergraduate and graduate studies", which is wider than most state Guard tuition programmes and is the part members most often leave on the table.

  • Catastrophic Entitlement — $150 a Month, and It Survives You

    This is not paid on a disability percentage. It is paid on one of seven named conditions. A veteran at 100% whose disabilities are not on that list does not qualify, and a veteran below 100% whose disability is on it may.

  • State PTSD and Readjustment Counselling — Family Included

    This is a New Jersey service, not the federal Vet Center programme. A veteran already turned away from one route should still ask about the other — they have different eligibility and different waiting positions.

  • Veterans Haven — Two Years of Transitional Housing

    Veterans Haven is not detox and not an emergency shelter. Being drug and alcohol free is required at the door, so a veteran still using needs a different service first — and should ask the admissions line which one, rather than waiting.

  • $250 Off the Property Tax Bill Every Year — No Disability Needed

    This is not the disabled veterans’ exemption. It needs no VA rating at all — active duty service and an honourable discharge are the whole service test. A veteran with no rating who assumed property tax relief was only for the disabled has been leaving $250 a year on the table.

  • Military Funeral Honours — Requested Through the Funeral Director

    The State department does not render honours and says so. A family that files a request with the department instead of asking the funeral director has filed with the wrong body, and the delay lands on the funeral date.

  • Refused a Job or a Flat Because You Might Be Called Up — That Is Illegal Here

    This is forward-looking, not backward-looking. The protection is about liability for service — a Guard or reserve member who has never deployed is squarely inside it. Veterans’ benefit guides file it nowhere, which is why most people who need it have never heard of it.

  • Getting to the VA Without a Car — the County Transport Directory

    There is no statewide veterans van and no state mileage reimbursement in this guide. What the state provides is the directory; the service is run county by county, and the quality of it is a county question.

  • The Veterans Diversion Program — a Route Out Before the Court Route

    This is not a veterans treatment court. It is a diversion programme run with the Attorney General’s Office and law enforcement, which is why the department’s own page is written to recruit mentors rather than to take applications from defendants.

  • Office of Women Veterans — the State Says It Makes No Distinction

    A published absence stated by the department itself, which is rare. Most states leave you to infer that there is no separate women’s scheme; this one writes it down.

Virginia

A first pass over Virginia statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Washington

A first pass over Washington statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Arizona

A first pass over Arizona statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Disabled Veteran Property Tax Exemption — Fully Exempt at 100% from 2026

    This record described Arizona's relief as modest and small next to its neighbours. From tax year 2026 a veteran rated 100% service-connected is fully exempt under A.R.S. 42-11111(C). The figures it declined to publish are also public: $4,873 for 2026, with income limits of $39,865 and $47,826.

  • Tuition Waiver Scholarship

    The Arizona test is residence or stationing AT THE TIME OF THE INJURY, not residence today. Someone who was an Arizona resident or stationed in Arizona when they were wounded may hold this even after moving away, and someone who moved to Arizona afterwards does not hold it at all. Summaries of this programme describe it as a benefit for Arizona veterans and drop the tense, which is the part that decides who gets it.

  • Initial Licence Fee Waived — Within Two Years of Discharge

    Universal licence recognition is not a fee waiver, and the two are constantly reported as one benefit. A.R.S. §32-4302 lists "the person pays all applicable fees" among its own conditions. The waiver lives in A.R.S. §41-1080.01 and has to be claimed there.

    Agency pages can understate the waiver. The board page we read quotes only the 200%-of-poverty-guidelines clause of §41-1080.01 and does not mention the veteran or military-spouse clauses at all. The statute contains all three. If an agency tells you the waiver is income-tested, point it at the section.

  • Arizona State Veteran Homes — Spouses Admitted in Their Own Right

    A non-veteran spouse can be admitted here on their own account. The department’s admissions statement reads "an honorably-separated Veteran or the spouse of a Veteran" — the spouse is an alternative, not a companion admission. Several state home systems do not work that way, so it is worth checking rather than assuming.

  • Military Family Relief Fund — Up to $3,000 in an Emergency, $20,000 Over a Lifetime

    The $3,000 emergency award is not extra. The department is explicit that it comes out of the veteran’s total $20,000 lifetime limit, so taking it now reduces what remains for later.

    Twelve months of continuous physical presence is one route among four, not a universal requirement. A veteran whose home of record was Arizona, who was in the Arizona National Guard at deployment, or who deployed from an Arizona installation does not need to prove the twelve months at all.

  • State Tuition Reimbursement for the Guard — and for Spouses and Dependants Too

    This is not a stack on top of federal education benefits. Subsection B conditions the guardsman’s reimbursement on lacking veterans’ benefits eligibility for the same period, which makes the two alternatives for a given semester.

    Spouses and legal dependants are inside the statute in their own right, not as an afterthought. So are employees of the state military department. Summaries that describe this as a member-only benefit are describing subsection B and stopping there.

  • Paid Military Leave for Public Employees — Counted in Shifts, With a Salary Top-Up in an Emergency

    There is no flat 30-day entitlement here, whatever a summary may say. The allowance is a multiple of your own average weekly scheduled hours, which makes it larger for long-shift rosters and smaller for short ones.

  • Your Employer Cannot Refuse You Leave for Guard Duty — and Refusing Is a Crime

    This section does not make the leave paid. It makes refusing the leave a crime. Those are different things and a member told "we cannot afford to pay you" has not necessarily been refused anything this statute protects.

  • Nobody Left to Bury You — the County Must Act, and Must Call the VA First

    This is not a burial allowance and it is not money paid to a family. It is a duty of last resort that engages only when nobody in the statutory hierarchy is willing or able to arrange the burial. A family that can pay will not reach it.

    A member who dies in service can have already decided this. The DD Form 93 route displaces the ordinary family hierarchy, and the person named on that form holds the duty. Families are frequently unaware the form exists, let alone who is on it.

  • Deployment Cannot Be Used to Take Your Parenting Time

    The ninety-day freeze is not automatic for every deploying parent. It is written for the parent the child resides with a majority of the time, and for orders that involve moving a substantial distance away. A parent without majority residence should read the temporary-order and delegation provisions instead.

  • A Pawnbroker Must Waive the Interest and Hold Your Goods Through a Deployment

    The waiver is of unpaid interest, not of the loan. Redeeming still costs the principal, and the goods are held rather than returned free.

  • Every Gym Contract in This State Must Let a Deployed Member Cancel or Suspend

    The deployment ground asks for federal active duty and deployment outside this state. Weekend drills, annual training in state, and a mobilisation that keeps you inside Arizona are not obviously inside it — read the wording against your own orders before you send the notice.

  • Mobile Home Park: Reassignment Orders Beat the Notice Period

    This is the correction that matters. The short-notice termination right is in the MOBILE HOME PARK act, not in the ordinary residential landlord and tenant act. We read both of the early-termination sections in the general act this session: one is written for domestic violence and sexual assault, the other for law enforcement officers. Neither reaches a servicemember.

  • Veteran Courts — Eleven of Them, and Most Sit in Municipal Court

    Arizona’s veteran courts are mostly municipal, not Superior Court. Six of the eleven entries on the department’s own list are municipal or consolidated city courts, and the Maricopa County Superior Court entry is marked probation only.

  • Hyperbaric Oxygen Therapy Fund — a State Fund for Veterans, Funded by Donations

    This is not on the department’s benefits landing pages and does not appear in the usual Arizona veteran benefit round-ups. It exists in the Revised Statutes, and asking for it by section number is the way to be taken seriously.

  • State Contracting — Arizona Has No Veteran-Owned Business Set-Aside or Certification

    Directories of "state veteran business certifications" routinely list all fifty states. Arizona has no such certification: the Procurement Code’s only set-aside categories are nonprofit agencies serving people with significant disabilities and Arizona Correctional Industries, and no veteran preference appears anywhere in Title 41.

  • Women Veterans — Arizona’s Page Points at Federal Programmes, Not State Ones

    Benefit round-ups sometimes list a "state women veterans program" for Arizona. The department’s own page on that exact subject contains federal and national programmes only, and no statute in Title 41 creates one.

  • Gold Star Family Plate — $25, of Which $17 Is a Donation

    This plate is not free, and a family expecting the fee waiver that valor plates attract in other states will be surprised at the counter. The $25 buys the plate and funds the veterans' donations fund; it is a charitable plate with a Gold Star design, structurally speaking.

  • A Disability Placard on a VA Certificate — No Doctor's Appointment Needed

    This is not a veteran benefit and is not listed as one, which is exactly why it is missed. It is a general disability provision with a VA-certificate door written into the evidence rule, and that door is the fastest one in the section.

  • The Widow's Exemption — and the Much Bigger One a 100% Veteran's Spouse Keeps

    The two limbs are constantly conflated. A widow's exemption of $4,188 of assessed value, capped by a $28,459 assessment ceiling, is a modest thing. The full exemption a 100% veteran's surviving spouse carries forward is not capped by that ceiling at all. A surviving spouse told they are limited to the small figure should ask which subsection the assessor is applying.

Tennessee

A first pass over Tennessee statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Property Tax Relief — a Reimbursement, Not an Exemption, and Four Routes Into It

    It is a reimbursement programme, not an exemption. You pay the bill and the state pays you back, which matters for cash flow in a way an exemption does not — and it means you must actually pay to receive anything.

  • Tennessee Has No Income Tax — For Anyone

    Tennessee finished phasing out the Hall income tax on interest and dividends and now levies no personal income tax. Presenting that as something the state does for veterans overstates it in exactly the way the Texas and Washington records correct.

  • Permanent Hunting and Fishing Licence for a One-Time $10

    The wartime route is NOT free, and this record used to say it was. That claim came from reading the two subsections of the code on a reproduction and inferring a fee difference between them. Both state publications say there is no difference: the veterans department describes a single licence "with a one-time $10 fee" for a veteran 100% permanent and total OR 30% or more disabled by reason of service in any war, and the wildlife agency's own application prints one line — Type 198, one-time fee $10 — covering both subsections at once. A veteran who turned up expecting a free licence on the wartime route was sent by us.

  • An Interview the Agency Must Offer, and the Tie-Break

    Tennessee no longer runs the points system older guidance describes. The preference is now a first-round interview the agency must offer, plus a tie-break on equal qualifications. A veteran looking for "five points" will not find them and may conclude there is no preference at all.

  • Disabled Veteran Plate — One, Free

    There is no half-fee second plate. This record used to say the second plate cost standard registration plus half the plate fee, which came from the section read on a reproduction. The Department of Revenue, citing the same section, says one plate is free and additional plates "may be purchased at the regular fee". The only veterans with two free plates are those grandfathered in on plates issued before 19 May 2014.

  • Tennessee State Veterans Homes — Five Routes In, Two Per Diems

    You do not have to live in Tennessee. Four of the five residency routes have nothing to do with where you live now — being born here, entering the armed forces here, a Tennessee home of record on the military record, or having a Tennessee-resident family member as your primary caregiver each qualify on their own. A veteran who moved away decades ago is not automatically out.

    The two per diems do different jobs. The Basic Per Diem discounts a private-pay bill; the Higher Per Diem covers the stay outright. Individual unemployability reaches the Higher Per Diem even where the combined rating is below 70 percent — so a veteran paid at the 100% rate on unemployability should ask for it by name.

  • Temporary Exemption from Licensure While You Transition

    An earlier gap note here speculated that § 62-76-105 might be a further veteran benefit. It is a low-income initial-fee waiver for public-assistance enrollees and has nothing to do with military service. The speculation is removed rather than left standing.

  • State Veterans Cemeteries — No Fee for the Veteran, and None for a Spouse or Dependent Child

    A $700 charge for interring an eligible dependent circulates widely in third-party summaries. The department’s own cost page states there is no fee for the interment of a veteran’s spouse or eligible dependent children. Ask the cemetery to confirm in writing before paying anyone anything.

    The eight-year reserve and guard route is new as of 6 June 2026 and has not reached most published guidance. A guard member who served eight years collectively, or who was called to service under state orders for any length of time, is now eligible where they previously were not.

  • STRONG Act Tuition Reimbursement — 100% of In-State Tuition, After Federal Aid

    Two Tennessee agencies publish different submission windows for this programme — 45 days from the last class on the military department’s page, 90 days from course completion on the veterans department’s. Work to the shorter one and ask the State TA Managers to confirm in writing.

    Declining federal tuition assistance does not increase the state payment. It removes it: the military department conditions the reimbursement on using federal tuition assistance where you are eligible.

  • County Motor Vehicle Privilege Tax — Waived for a 100% Disabled Veteran or a Former Prisoner of War

    A former prisoner of war does not need a 100 percent rating to claim this. The two routes stand independently in the section the department cites.

  • Veteran Designation on Your Driver Licence or Photo ID

    The designation is not free-standing of the licence fee. It is a marking on a licence you pay the ordinary price for, and taking it early means paying a duplicate fee on top.

  • Tennessee Fallen Hero Medal — for the Immediate Survivor of an Active Duty Death

    The 1 July 2011 cut-off is absolute on the department’s own page. A family told the medal can be requested for an earlier loss is being told something the department contradicts.

  • Unclaimed Veteran Remains — a State Cemetery Burial When No Next of Kin Comes Forward

    The clocks in this procedure are counted in hours, not in weeks. 72 hours to claim after notification and 168 hours to locate a next of kin is a fortnight shorter than most people assume they have, and a family that only starts asking questions a month later is arguing against a window that has already closed.

  • Honor and Remember Flag — the State’s Symbol of Remembrance, With No 2011 Cut-Off

    A family turned away from the Tennessee Fallen Hero Medal should not assume it has been turned away from the flag. The medal is confined to combat circumstances and to deaths on or after 1 July 2011. The flag’s published wording — lost their lives while serving, or as a result of service — carries neither limit.

  • Falsely Claiming Military Service Is a Crime in Tennessee

    This is a criminal offence, not a private right to sue. Reporting it starts a prosecution decision by law enforcement and a district attorney general; it does not produce damages for the veteran who reported it.

  • Military Medal Protection — Abandoned Medals Are Held by the State Treasurer, Not Sold

    A medal surrendered to the state as abandoned property is not liquidated the way abandoned cash or securities are. The department’s wording is that it is held until the owner or the owner’s heirs or beneficiaries can be identified for its return.

  • No Statewide Veteran Utility Discount — What Tennessee Actually Has Is Income-Tested

    Tennessee is regularly listed as offering veterans a utility discount. On 23 August 2026 neither the utility regulator’s consumer division nor the state energy assistance programme described one on its own page. The help that exists is income-tested and available to any household that qualifies, veteran or not.

  • Veterans Treatment Courts — Twelve Named Programmes, Six of Them Outside State Funding

    This is not on the Department of Veterans Services’ benefits page. That page was read in full this session and lists property tax relief, recreation, motor services, burial, state homes, wine shipping, discharge registration and the medal protection programme — and no court programme at all. A veteran looking only there will never find this.

  • Service-Disabled Veteran Business Certification — Now GO-BID, and the Threshold Is 20%

    The office is no longer called Go-DBE. Supplier directories, university procurement pages and consultants still use the old name and the old links, and those links now return errors. The certification itself, including the service-disabled veteran category, continues under GO-BID.

Massachusetts

A first pass over Massachusetts statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Categorical Tuition Waiver for Veterans

    "Space available" is doing a lot of work. This is not an entitlement — each institution decides availability under its own published practice, so two veterans with identical service can get different answers at different colleges in the same year.

  • Free Licence for Residents with Disabilities

    This is not a veteran benefit and no veteran-specific licence was found. A veteran reaches it through the disability, which means a 100%-rated veteran whose condition is not one of those listed gets nothing here, and a 10%-rated veteran who is paraplegic gets the widest version.

    Free is not quite free. The agency’s 2026 fee schedule states that its listed prices do not include the $5 Wildlands Conservation Stamp, which is added to the first resident licence bought each year and to every non-resident licence. A free licence therefore still costs $5 the first time each year, plus the $2.75 administrative fee and any agent or online convenience charge if you do not buy at an agency office.

    The discounted and free licences are open only to United States citizens — the agency states that restriction under every fee table. It is not in the disability test itself and it catches lawful permanent residents who would otherwise qualify.

  • Absolute Civil Service Preference

    Veteran status here follows the Massachusetts wartime-service definition, not federal veteran status. Peacetime-only service generally does not carry the preference, and a veteran told simply that "Massachusetts has absolute preference" will overestimate their claim.

    Absolute preference is not absolute on the two lists most veterans are chasing. The Human Resources Division states that on Firefighter and Police Officer lists the veteran ordering is superseded by the residency preference in M.G.L. c.31 §58 — so a non-resident veteran can rank below a resident non-veteran on exactly those lists.

    Remarriage closes the survivor route. The division states the spouse or single parent of a veteran killed in action, or dead of a service-connected disability incurred during wartime service, holds the third place in the list order only "provided that the spouse or parent has not remarried".

  • Disabled Veteran Plates — 60%, and the 60% Has to Be About Walking

    This record used to say the plate had two doors — 60%, or a loss-of-use or vision test at any percentage. The Registry’s own eligibility statement, read 23 August 2026, does not run it that way. It sets three conditions that must all hold together: permanent disabled parking eligibility, a minimum 60% rating on the disability breakdown letter, and disabilities within that 60% that affect ambulation. The record has been changed to follow the agency that issues the plate.

  • Licence Fee Waived, Military Training Credited, and 90 Days After Active Duty

    The waiver is of "the commonwealth’s portion" of the fee, not of the whole cost of getting licensed. Where a profession’s fee is split between the Commonwealth and a testing or credentialing vendor, expect to pay the vendor side.

    There is a real downside the licensure bureau publishes and the summaries do not: accepting the active-duty benefit "may result in the military deeming your license to be restricted even though it is not restricted under Massachusetts law." Nurses in particular should read the bureau’s own clarification letters before taking it.

  • Veterans’ Homes — Charges Capped at $30 a Day

    The charge is capped, and that is the fact worth knowing. However high a resident’s income goes, long-term care is charged at no more than $30 a day or $930 in a 31-day month. Families budgeting against private nursing-home rates are usually working from a much larger number.

    The minimum service requirement is waivable. A veteran who served some time in a campaign and was awarded the Purple Heart, or who suffered a service-connected disability, does not need to have completed the 90 or 180 days. That exception is on the eligibility page and is routinely dropped from summaries.

  • Service-Disabled Veteran-Owned Business — a 3% State Spending Benchmark

    The Commonwealth does not run its own ownership test for this status. It adopts the federal definition and the federal verification — so a firm that has not been verified federally cannot be counted toward the benchmark here, however clearly it is owned by a disabled veteran.

  • Chapter 115 Benefits — Monthly Cash and Medical Costs, Paid by Your City or Town

    This is not an emergency grant and not a one-off cheque. It is an ongoing entitlement with a monthly payment and a medical side, and it has no end date while the need and the eligibility last. Veterans routinely turn it down having been told it is a hardship fund.

    The residence test is one day. §5 requires that the veteran "actually resided within the commonwealth for 1 day preceding the date of their application", and imposes no waiting period at all on a veteran who lived here when they entered or continued in service. Do not let a supposed multi-year residency rule stop you applying.

  • Veteran Annuity — $2,500 a Year, Paid Once Annually

    The payment schedule changed and old guidance is still circulating. It is no longer two half-payments in August and February: from August 2025 it is a single annual cheque of $2,500.

  • Veterans Memorial Cemeteries — No Charge for the Veteran, $300 or $150 for Family

    Twenty years in the Guard or the reserves with a pension, or with documentation of retirement pay at 60, is a complete route on its own. A family that assumes active-duty service is required rules itself out of a benefit the office grants.

  • National Guard Tuition and Fee Waiver — and 130 Hours a Member Can Pass to Dependants

    The 130 hours are not per person. M.G.L. c.33 §137A caps them per member, including hours transferred to dependants — so a member who studies to a degree themselves may have little or nothing left to pass on.

    This is a different benefit from the categorical tuition waiver open to Massachusetts veterans under M.G.L. c.15A §19. That one is tuition only and space-available; this one covers fees as well.

  • Public Service Scholarship — for Children of the Killed, the Missing and the Captured

    The prisoner of war and missing in action route is period-limited and place-limited: Southeast Asia, and service between 1 February 1955 and the termination of the Vietnam campaign. It is not a general provision for the families of prisoners of war.

  • SAVE — a Peer Outreach Team Whose Job Is Preventing Veteran Suicide

    This is not a clinic and it is not a waiting list. It is an outreach team that travels, and its own account of its work includes veterans who have been shut out of federal benefits by their discharge.

  • Veterans’ Burial Allowance — Up to $4,000, Paid by Your City or Town

    The figure is $4,000. A $2,000 burial allowance is still repeated widely for Massachusetts; the section as amended by the HERO Act, St. 2024, c.178, §124, effective 8 August 2024, says not more than $4,000.

    The $5,000 sentence is a condition, not a cap on the payment. If the whole cost of the funeral and burial exceeds $5,000, the section’s own terms are not met — so the funeral is the decision to take before the paperwork, not after it.

  • Every Veteran’s Grave, Kept by the Town — and a Flag on It Every Memorial Day

    This has nothing to do with the two Commonwealth cemeteries. It reaches a veteran’s grave in any cemetery in any city or town in the Commonwealth, including a family plot in a small private burying ground.

  • The Servicemembers Case — a Court Step Massachusetts Puts in Front of a Foreclosure

    A Servicemembers case is not a foreclosure and the filing of one does not mean a foreclosure will follow. It also does not close off a loan modification or other foreclosure-prevention options — the court says so directly.

    The protection only reaches a mortgage taken out before military service began. A mortgage signed after service started is outside it, however hard the deployment made the payments.

  • Leave to Observe Veterans Day, and to March on Memorial Day

    The leave is required; the pay is not. An employer who grants the day unpaid has done what the statute asks, and a veteran expecting a paid holiday is reading the law more generously than it reads itself.

    The Memorial Day entitlement is narrower than the Veterans Day one. It is sufficient time to take part in an exercise, parade or service in the veteran’s own community of residence, not a day off.

  • Utility Discount Rate — Three Veteran Doors onto 25% to 71% Off Delivery

    This is not a veteran discount. It is the low-income discount rate, and the veteran programmes are three of the many doors onto it — which is why a veteran told "there is no veteran rate" has been answered accurately and unhelpfully at the same time.

    The discount applies to the delivery portion of the bill, not the whole bill. On a bill where supply is the larger half, a 71% figure will not halve what you pay.

  • State Park Parking — Daily Fees Waived on Three Plates, and Veterans-Only Spaces

    The daily fee waiver and the reserved spaces are two different things with two different plate lists. A plain Veteran plate opens the designated spaces but is not among the three plates the Department names for the fee waiver.

  • Veterans Treatment Courts — Seven of Them, and You May Be Able to Move Your Case to One

    The commonest reason a Massachusetts veteran misses this is geography — the assumption that a court without a veterans session is the end of it. The Specialty Courts Department says the opposite: transfer to a court that has one may be an option.

  • Rides to VA Care — Named Regional Services, Not One Statewide Number

    There is no single Massachusetts veterans transport programme. What exists is a set of regional services with different operators, different catchments and different terms, listed in one place by MassMobility. Asking the Executive Office of Veterans Services for "the veterans van" gets you pointed back at this list.

  • Women Veterans Network — Community and Advocacy, Routed Back to Chapter 115

    The Network is published at modest weight on purpose. Read its own benefits page and the Massachusetts content is the Veterans’ Service Officer and Chapter 115 — the same doors open to every veteran in the Commonwealth. The Network is the way in and the community around it, not a separate entitlement.

  • The HERO Act Stops the Registry Charging You — Registrations, Licence Fees, Excise and Sales Tax

    The exceptions are where this goes wrong at the counter. "No registration fees" does not mean no special plate fee and no reinstatement fee; "no driver’s licence fees" does not mean no permit fee, no road test fee, no Mass ID fee and no professional credential fee. The Registry lists all eight exceptions on the same page as the exemptions.

    The eligibility test for the excise exemption changed under the HERO Act and old refusals may no longer stand. It is now the federal veterans department’s disability determination that decides it, not the Registry’s Medical Advisory Board.

  • The Veteran Indicator — Free Duplicate If Your Licence Is Not Due

    The long-form condition is the one that sends people home. A DD-214 short form, the version many veterans carry because it omits the discharge characterisation, is not accepted — the Registry asks for the full page and says so.

Indiana

A first pass over Indiana statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Missouri

A first pass over Missouri statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Maryland

A first pass over Maryland statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Minnesota

A first pass over Minnesota statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Wisconsin

A first pass over Wisconsin statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Oklahoma

A first pass over Oklahoma statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Sales Tax Exemption Card — $25,000 a Year

    No other state in this corpus exempts a disabled veteran’s everyday purchases from sales tax. Veterans moving into Oklahoma from any other covered state will not think to ask for this, because nothing in their old state resembles it.

  • DAV Plates at 50% — Two Vehicles

    Source replaced 23 August 2026. This record previously cited a commercial mirror of the administrative rule, which is not a source this corpus may rely on, and recorded the plate fee as unknown. Every primary host was tried that day and refused: the state courts network that publishes the statutes refused every connection, the administrative rules host held at a challenge page in a browser, and the Secretary of State's rules portal answered HTTP 401. The authority is now the agency's own plate catalogue, which also settles the fee — $6.50 picked up, $13.10 mailed — and names the documentation as the ODVA Form 599 card or an ODVA letter rather than the form previously recorded.

  • Preference Points, a Required Interview, and a Pass-Over Review

    The points and the interview are commonly reported as one benefit. They are not. Subsection D applies "in addition to" the points, so a veteran who does not place high enough on a register still has a claim to the interview if the basic qualifications are met.

  • Heroes Promise — Tuition for Children of the Fallen

    Two conditions the shorthand summaries drop: the decedent must have filed an Oklahoma income tax return for the tax year before the year of death, and the child must enrol before age 21 — either one missed forfeits a benefit the family plainly "deserves" on the headline facts.

  • Oklahoma Veterans Centers — Long-Term Care

    Spouses and surviving spouses are admitted only "on exhaustion of placement of all eligible Veterans" — that is, after every eligible veteran on the list has a bed. A couple planning to move in together should ask about the current position of that list rather than assume joint admission.

  • Military Service Occupation, Education and Credentialing Act

    The licensing fee waiver is not a veterans' waiver. §4100.8(D) waives the application fee and the first-period licence fee for "active duty military personnel and their spouse". A discharged veteran with no active-duty status gets the credit-for-training provisions, not the fee waiver.

  • Service-Disabled Veteran Business — Three-Point Bid Preference

    This is a three-point scoring bonus, not a set-aside and not a price preference. A bid three points behind on the merits still loses.

  • State Veterans Cemetery at Ardmore — $0 for the Veteran and the Spouse

    The spouse is not charged here. Several states in this corpus charge a spouse or dependant several hundred dollars for the same interment; this cemetery publishes $0 for both, marked subject to change.

  • Driver Licence — No Fee at a 100% Permanent Rating

    This is not a "disabled veteran" waiver in the loose sense. Compensation at the one-hundred-percent rate for a permanent disability is the test printed by the agency, and a permanent rating below 100% does not meet it.

  • Military Pay — 100% Deducted From Oklahoma Taxable Income

    Pay and retirement are two different provisions and are routinely confused. The veterans agency prints 100% for salary or compensation while serving, and a much smaller figure for retired pay.

  • Pension Money of a Veteran Disabled in Service — Exempt From Levy

    The general exemption list is the one everybody quotes, and it protects a homestead, a vehicle to $7,500, tools to $10,000, five milk cows and one hundred chickens — and says nothing about veterans. The veteran protection is a separate section six numbers later. Reading only §31-1 gives the wrong answer.

  • No State Military Lease-Termination Right — the Federal Act Is the Whole Route

    Guides regularly describe a state lease-termination right for servicemembers here. There is none. Everything they describe is the federal Act, restated.

  • Veterans Registry — the Gate to the Licence Indicator and the Sales Tax Card

    The sales tax exemption record in this corpus describes the exemption itself. It does not tell a veteran that since 1 November 2021 registry enrolment sits in front of it — a holder from before that date who never registered can lose the exemption without ever being told why.

  • Energy Assistance Has No Veteran Route — Apply on the Ordinary Criteria

    Utility discounts for veterans are one of the most repeated claims in benefit round-ups. On the state programme page there is no veteran preference, no supplement and no set-aside. Some other states do add a veteran supplement; this one, as published, does not.

  • Special Housing Grant — Up to $5,000 on Top of the Federal Adapted Housing Grant

    This is easy to mistake for a home-purchase grant. It is not. The section describes bearing costs not borne by the federal government for a specifically designed home — the adapted-housing route, not an ordinary mortgage.

  • Indigent Veteran Burial Grant — Up to $1,000 Where Nobody Claimed the Remains

    This is not a general state burial allowance for veterans’ families. Round-ups often present it as one. The unclaimed-remains condition is in the statute and it is the whole point of the programme.

  • PTSD as a Mitigating Factor at Sentencing — What the Court May Consider

    This is a sentencing provision, not a veterans treatment court. Title 22 as published by the Senate was read through this session and contains no veterans treatment court statute. Any such court operating in a county does so under some other authority, which was not established here.

  • Veteran or Young Farmer Grant or Loan — Farm Money With a Veteran Route

    The state veterans department’s own farming page points at a national coalition and a chapter that is reorganising. That is a membership network, not money. The funding is at the agriculture department, under a different name, and the two pages do not link to each other.

  • Four Gold Star Plates — $27.10 to Issue, $22.16 to Renew

    Guides that list Gold Star plates among a state’s free plates are not describing this state. The agency’s own catalogue prices all four at $27.10 to issue and $22.16 to renew, which is higher than most of the military plates alongside them.

  • A Surviving Spouse Registers One Vehicle at the Disabled Veteran Rate

    The online renewal channel silently defeats this benefit. Renewing online charges the ordinary rate, and nothing on the way through warns a spouse that the discount is only available on the mail and counter channels.

  • The Placard Comes First — You Cannot Get the Disabled Plate Without It

    A disabled veteran plate is not a disabled-parking credential here. The physically disabled plate is a separate product on a separate medical test, and the agency requires the placard before it will even take the plate application.

South Carolina

A first pass over South Carolina statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

West Virginia

A first pass over West Virginia statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Nevada

A first pass over Nevada statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Disabled Veteran Exemption — Tiered and Inflation-Indexed

    Nevada levies no personal income tax on anyone. Lists that present that as a veteran benefit overstate it — it is the state’s tax system, not a concession to veterans, and this corpus records it here rather than as a benefit.

  • Wartime Veteran Exemption

    The name misleads: 90 continuous days of active duty, or service in any campaign for which a medal was authorised, qualifies without wartime-era dates.

  • $15 Combination Licence — For Every Nevada Veteran

    Summaries present this as a disabled-veteran licence at 50%+. The state veterans department states it plainly: ALL Nevada veteran residents buy the $15 specialty combination licence — the disability route is one door among several, and the price is the same.

  • Nevada State Veterans Homes — Skilled Nursing and Memory Care

    The two homes do not publish the same cost. The northern home's rate card shows $173.00 a day for a veteran and $280.00 a day for a spouse or Gold Star parent; the southern home describes its cost as about $125 a day. Quote the home you are applying to, not a state average.

    The VA subsidy is for eligible veterans and not for spouses. A couple should not assume one approval covers both sides of the bill.

  • State Veterans Memorial Cemeteries — Free for the Veteran, $450 for a Spouse

    A family does not get separate plots. One gravesite is authorised for all eligible members of a family, with burials stacked in the same plot — the exception is soil conditions or a number of decedents that forces a second grave.

    Pre-registration does not hold a place. It buys an advance determination of eligibility; the grave itself is assigned only at need.

    Military honours are not part of the service. The cemetery system states it does not provide them and that the family must arrange them in advance.

  • National Guard Fee Waiver — Registration and Laboratory Fees, Not the Professional Schools

    The veterans department describes this as a tuition waiver with some fees waived depending on the institution. The System describes it as a waiver of registration and certain laboratory fees, with the professional schools excluded. Plan against the narrower description.

  • Energy Assistance Has No Veteran Route — Four Criteria, None of Them Service

    Utility discounts for veterans are among the most repeated claims in benefit round-ups. The administering agency’s own eligibility page lists four criteria and none of them is service. Some other states do add a veteran supplement to energy assistance; this one, as published, does not.

  • Veterans Treatment Courts — Which Courts Run One, and Which Counties Have None

    The judiciary says specialty court programmes exist in every county, urban and rural. That is true of specialty courts as a whole and not of veterans dockets: on the directory read this session, every veterans docket is in Clark or Washoe County.

  • Gold Star Family Plate — $8.50 Once, and It Stops You Paying to Park

    The plate is usually described as a memorial plate and nothing more. The department’s own pages say otherwise in two places: it carries a parking fee exemption at any facility owned by a state or local government agency. That is a recurring, quantifiable benefit hiding inside a recognition plate.

  • Veteran Designation for $8.25 — Free at Renewal — and the Placard That Still Pays the Meter

    The intuition is exactly inverted here. People assume the medical placard is the one that gets them out of paying, and the veteran plate is decorative. The department says the opposite on its own page: placards do not waive parking fees, and the Disabled Veteran, Fallen Military and Gold Star plates do.

    The veteran designation is not free in general — it is free only when it rides along with a transaction you were doing anyway. Walking in specifically to add it costs $8.25, or $12.25 on a commercial licence.

  • Veteran-Directed Care Reaches Eastern Nevada Only — Here Is What Covers the Rest

    The self-directed programme is often listed as though it were statewide. The state veterans department’s own page ties it to eastern Nevada and to a federal medical centre outside this state. Veterans in the two population centres are not in it, and should go straight to the federal caregiver programmes and the respite coalition instead.

New Mexico

A first pass over New Mexico statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Oregon

A first pass over Oregon statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Utah

A first pass over Utah statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Armed Forces Exemption — Ceiling × Your Rating

    The 10% floor is the story. Veterans assume property relief starts at 50% or 100% because in most states it does; Utah shields ceiling-times-rating from 10% up, so a 30% veteran holding nothing in a neighbouring state shields roughly $160,000 of taxable value here.

  • Purple Heart Plate — No Contribution, Standard Fees Only

    "No contribution" is not "no cost". Utah publishes the two separately and a veteran reading only the headline would arrive expecting a free plate and be charged about twenty dollars.

  • State Parks Honor Pass — or Just Your VA Benefits Letter, Until the Lifetime Pass Launches

    Position updated 23 August 2026. This record previously described a single pass with no transition. The department’s 2026 resource guide, read that day, states that a LIFETIME Veterans Honor Pass is being prepared with the federal department and is pending final approval, and that until rollout a veteran should keep using the 2025 pass with a VA summary of benefits letter showing residency or ANY disability rating — the letter remaining valid for entry even after the new pass launches. Do not surrender or stop carrying the letter.

    Secondary summaries state a 50% disability threshold and a specific guest count for the pass. The veterans department pages we read state neither — the recreation page requires only "a service-related disability" with a current VA letter, and the 2026 guide says ANY rating. If the parks apply a stricter gate at pickup, it is not in the published eligibility.

  • Disabled Veteran Plate — No Contribution, Standard Fees Still Apply

    An earlier pass left open whether the plate-fee exemption in §41-1a-1211 reaches this plate through its §41-1a-407 cross-reference. The DMV's own fee table answers in practice: the Disabled Veteran plate is charged the standard plate fee, the special group plate fee and the registration certificate fee — only the specialty contribution is $0. Descriptions of this as a free plate overstate it.

  • Utah Veterans Homes — No Cost at 70 Percent or Higher

    The $120 a day is a VA per diem paid toward the cost of care, not the price of a bed and not a payment to the veteran. Below 70 percent, the difference between the home's charge and that per diem is the resident's to find.

    Spouses and Gold Star parents are admitted but not subsidised. The department says the cost of their care is not covered or subsidised by the VA.

  • Utah Veterans Cemetery — Free for the Veteran, $1,002 for a Spouse

    The paperwork route runs through the mortuary, not the family. The DD-214 goes to the funeral home, which sends it on and books the graveside time.

  • First-Time Homebuyer Grant — $2,500, Within Five Years of Separating

    This grant turns on how recently you served, not on a disability rating. A veteran five years and one day out is outside it; a veteran with no rating at all who separated last year is inside it.

    First-time buyer is read locally. Having owned a home in another state does not disqualify the applicant — the programme page says so in terms.

  • Guard State Tuition Waiver — Full-Time Tuition, Deadline 30 April

    The waiver is not a general Guard tuition benefit with rolling enrolment. It is an annual, competitive-looking packet with an essay and transcripts, due 30 April, for full-time study only.

  • Guard State Tuition Assistance — $7,000 a Fiscal Year, Two-Year Commitment

    This is not a grant in the ordinary sense. Signing the agreement incurs a two-year service commitment, and the money is recoupable on a failed grade, a withdrawal, or an early separation.

  • Military Retirement Credit — 4.5% of the Pay, Not an Exclusion

    The veterans department’s own 2026 guide describes this as retirees "excluding their military retirement pay from state income taxes". The tax commission describes a nonrefundable credit of 4.5 percent of that pay. On $30,000 of retired pay those two descriptions are about $1,350 apart in what they promise. Budget from the commission’s version.

  • Utah Honors Veterans Plate — $25 to Start, $10 a Year, and the Money Goes to Veterans

    This is not a veteran-only plate and it is not free. It is a fundraising plate anybody may buy, and the corpus already carries the separate disabled veteran plate, which has a zero contribution but its own standard fees.

  • Gold Star Plate — No Contribution, and Four Ways to Prove the Award

    Zero contribution does not mean zero cost. The plate carries no charitable contribution at all, but the standard plate fee, the special group plate fee and the registration certificate still apply, and a set adds $3.00 plus shipping.

  • Veteran Indicator on a Licence or ID — In Person Only, Never at an Online Renewal

    The online renewal channel quietly defeats this. Nothing in an online renewal offers the indicator, and once the card is reissued a veteran is generally waiting for the next cycle or paying for a duplicate.

  • The Disabled Placard Has No Veteran Route — and a DV Plate Will Not Park You

    This is a published ABSENCE of a veteran route, kept because the assumption is so common. Nothing on the division’s disabled parking page turns on service, a rating or a discharge, and the reserved-space rule names only the disabled person’s plate or placard. A veteran holding a disabled veteran plate and nothing else may not use a reserved accessible space.

Alabama

A first pass over Alabama statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • H-3 Homestead Exemption — Total, at Total Disability

    This is not a veteran statute. H-3 exempts the homestead for ANY permanently and totally disabled Alabamian — a 100% permanent and total veteran qualifies through the disability, with the VA certification as proof. Veteran-benefit lists that present it as a veteran exemption have the shape wrong, and non-veteran routes exist beside it.

  • G.I. Dependent Scholarship — Ten Semesters per Child, From 40%

    Older guides describe this as unlimited free tuition. Since the 2017 reform the programme bills tuition at up to $400 per credit hour and books-plus-fees at up to $1,000 per student, with other aid applied first — generous, but a capped scholarship, not a blank waiver.

  • Disabled Veteran Registration Fee Exemption — First Plate, Any Rating

    Two things the summaries get wrong here. The exemption is not tied to the distinctive plate — the department says a disabled veteran need not obtain it to claim the registration-fee exemption. And it is not an ad valorem exemption: the vehicle still owes ad valorem tax unless the federal VA helped pay for the vehicle itself.

  • Alabama State Veterans Homes — Admission and What You Pay

    The homes list "Free nursing home care" among the things they do not provide. Every resident is responsible for full payment of the comprehensive care rate, payable one month in advance, and failure to pay results in discharge. Free care is the federal exception, not the state rule.

    The federal exception has two routes and both require a need for nursing home care: either the care is for a VA-adjudicated service-connected disability, or the veteran has a service-connected rating of 70 percent or more, or a total rating based on individual unemployability.

  • Disabled Veteran's Business and Occupational Licence Reduction

    The dollar ceilings were never indexed. §40-12-352 excludes any veteran whose property, real and personal, is valued at $5,000 or more, or whose net annual income is $2,500 or more. Almost no working business owner today is under either line, so the exemption is far narrower in practice than the headline suggests.

    It is a reduction, not a flat $25 licence. The statute says the veteran pays the prescribed licence tax "less all or such portion of such license taxes as shall not exceed $25" — that is up to $25 off, at each of the state, county and municipal levels.

  • Five Points, Ten With a Rating — and the Tie-Break on the Register

    The five points are not limited to a war era or to a recent discharge. The compilation reads "honorably discharged from the United States Armed Forces at any time".

    The register preference is separate from the points and does not depend on a disability. Even where two candidates finish level, the veteran takes preference over the non-veteran.

  • Preferred Vendor Status — 5% of Headroom, and It Is Discretionary

    This is discretion, not entitlement. The compilation says the status allows for, but does not require, selection of the veteran-owned bid over a lower one.

  • Your Licence Survives the Deployment — Good Standing Into the Following Year

    The good-standing rule is a minimum, not a fixed term. The compilation reads "until, at a minimum, December 31 of the first year following the end of his or her deployment" — a board may allow longer.

  • National Guard Educational Assistance — Need-Based, With a Four-Year Clawback

    Guard tuition programmes are usually entitlements. This one is need-based and sits behind federal benefits: if aid already covers the cost within $100, there is nothing to award.

  • Death on Deployment — 180 Days Before a Foreclosure May Start

    The department files this rule under the heading "Military Family Relief Fund", which is where the penalty money goes. The rule itself is a foreclosure bar, and anyone scanning the headings for help with a mortgage would scroll straight past it.

  • Credit Under Federal Veterans Legislation Is Outside the Usury Law

    This sits in the veterans department’s own list of laws affecting veterans, between two genuine reliefs. It confers nothing on the borrower — it disapplies a consumer protection to a class of credit. It is published here at weight zero so that it stops being counted as a benefit.

  • Unclaimed Veteran Cremains — the Funeral Home Must Try to Find Out

    The department publishes a postal address for approval requests with a ZIP that reads 636102. The state ZIP for that office elsewhere on the same site is 36104. Confirm the address before posting anything.

  • Veterans Service Offices — Sixty-Two Counties, and What They Will Actually Do

    Sixty-two offices is not sixty-seven counties. The department says so itself. Assuming your county has one, and giving up when it does not, is the failure mode this record exists to prevent.

  • Military Records — the Expedited Route at a Death, and the Guard’s Own Archive

    Guard service records are not held with the rest. Asking the national archive for an NGB 22 is a common wasted month; the state Guard holds them and takes about three weeks.

  • Gold Star Family Plate — One Free Plate, and a Wider Family Than You Would Guess

    The affidavit route is the part that gets lost. Guides describe this plate as needing a Report of Casualty full stop, which quietly excludes every relative who is not the named next of kin — usually siblings and grandparents. The rule provides for exactly that case and sends them to a veterans service office instead.

  • Eight Valor Plates for Life — and They Do Not All Cost the Same

    The Medal of Honor category names the widow of a recipient directly, before the general surviving-spouse clause is even reached. That is a drafting quirk worth knowing: a Medal of Honor widow has an independent entitlement written into the list, not merely a retention right derived from her husband's.

  • Energy Bill Help — No Veteran Discount, but a Disabled Veteran Is a Targeted Household

    A veteran-specific utility discount does not exist in this state and, on the evidence of this round, barely exists anywhere. What exists is assistance that pays part of the bill, and a veteran reaches it through income and disability like everyone else — not through service.

Alaska

A first pass over Alaska statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Arkansas

A first pass over Arkansas statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Homestead and Personal Property — Exempt in Full

    Two of the three routes have no percentage at all: special monthly compensation for loss or loss of use of a limb, or for total blindness in one or both eyes, qualifies regardless of the combined rating.

    Re-sourced on 23 August 2026. This record previously rested on a commercial reproduction of the code, which was removed. The veterans department's own guide, which quotes the section, confirms the two eligibility routes, the exemption from ALL state taxes, and the coverage of personal property as well as the homestead. It does not confirm the no-annual-renewal rule or the reinstatement of a surviving spouse's exemption on the end of a later marriage, so both claims have been withdrawn rather than restated.

  • Lifetime Licences — $3 at 100%, $52.50 at 70%, and a Retiree Tier at 60

    News coverage says the threshold "dropped from 100% to 70%" — that describes the $52.50 stamp-inclusive tier only. The $1.50/$3 tier remains a 100% permanent-and-total product.

  • Military Dependents' Scholarship — Tuition, Room AND Board

    Most state dependent programmes waive tuition alone. This one waives tuition, FEES, and room and board in campus facilities — for a residential student the housing is worth as much as the teaching, and summaries that call it a "tuition waiver" undersell it by half.

  • Hiring Preference That Also Reaches Promotion and Retention

    This is not a hiring-only rule. The portal states the preference applies to hiring, promotion and retention — the retention limb is the one nobody claims, and it is the one that matters when posts are being cut.

  • National Guard Tuition Waiver — Tuition and Mandatory Fees, Public Institutions Only

    Holding a bachelor’s degree already closes the door. This is a first-degree programme, so a Guard member returning for a second bachelor’s or a master’s is outside it however good their standing.

  • One Free Birth or Death Certificate for a Veteran — the Form Nobody Knows About

    This is not a death-certificate benefit. The form has a tick box for BIRTH and a tick box for DEATH, and the code section it cites is the same for both — which is the opposite of how neighbouring states in this corpus write the same relief.

  • Automatic Occupational Licensure — the Requirement Is Waived, the Fee Is Not

    The page is headed "Fee Waiver" and its own text says the applicant "must still pay the initial license fee". Automatic licensure waives the requirement to meet this state’s qualifications, not the cost of the licence. Anyone budgeting on the heading will be short.

  • Military Funeral Honours Stipend — Paid to the Honour Guard, Not the Family

    This is not a burial allowance and must not be read as one. No money reaches the family from it. Its practical value to a family is that a volunteer honour guard can afford the detail.

  • Free Veteran-Produced Branding, and a Metal Sign for the Gate

    This is branding, not finance. Guides that file it under farm funding mislead: the department names no state loan, no state grant and no land route for veteran farmers, and the one financial element on the page is a privately funded scholarship that was closed when read.

  • Disabled Parking Placards Are Free — and Have No Veteran Route

    Benefit lists file the free disabled parking placard under veteran benefits in state after state. Here it is not one. It is free to every resident who can get the form signed, and no VA rating shortens or substitutes for the clinical certification.

  • A Respite Voucher for Caregivers Everything Else Turned Down

    This is not a veteran programme and should not be presented as one. It reaches an ageing veteran through the person caring for them, which is a different door: the applicant is the caregiver, the money is paid on the caregiver's W-9, and the veteran's service is irrelevant to the decision.

Colorado

A first pass over Colorado statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Half of the First $200,000 — P&T or IU

    Amendment G (2024) extended this to veterans on individual unemployability. Guidance written before it says 100% permanent and total only, and an IU veteran reading it would wrongly conclude they are shut out.

  • Lifetime Small Game and Fishing Licence — Free at 50%

    Widely circulated summaries put this gate at 60%. CPW’s own page says 50% or higher — or a Purple Heart with no percentage at all.

  • Veterans Assistance Grant and Veterans Trust Fund — Organisations Apply, Not Veterans

    This is not an emergency fund you can apply to. Both programmes are grants to organisations, and no veteran-facing application exists for either.

    The two funds are split by tax status, not by need. A 501(c)(19) or (23) veterans service organisation is barred from the Veterans Assistance Grant and is the only kind of body allowed into the Veterans Trust Fund — so the same project can be eligible for one and ineligible for the other.

  • Property Tax Deferral — the Called-Up Track, and Its Better Equity Test

    This is not the disabled veteran exemption and it is not a second exemption. Nothing is forgiven: the state lends you the tax, records a junior lien, and charges interest until the loan is repaid. A veteran can hold the exemption and this deferral at the same time, which is what makes the two easy to confuse.

    The tax-growth track is gone. Until SB25-261 a homeowner who was neither a senior nor called up could defer once their tax rose past a set percentage; no new application on that basis has been possible since the 2026 cycle. Existing tax-growth loans stay in place on their original terms.

    File with the county treasurer, not the state. SB25-261 handed dissemination, acceptance, review and recording of applications back to counties for 2026. Guidance written between 2022 and 2025 sends applicants to the state treasurer and is now wrong on the most basic step.

  • National Guard Tuition Waiver — the Programme That Replaced Tuition Assistance

    State Tuition Assistance paying up to $5,000 a semester no longer exists. SB25-247 converted it into a tuition waiver in 2025, and material still describing a per-semester dollar payment is describing a programme that closed. The practical difference is large: a waiver can cover more than $5,000 of tuition, and can also cover nothing at all if other aid has already cleared the bill.

    The waiver is last-dollar, not first-dollar. Federal tuition assistance, grants and scholarships are applied first, and the waiver takes the remainder. A member planning to bank federal aid for living costs while the state pays tuition has the order backwards.

  • Veterans Memorial Cemetery of Western Colorado — Burial at No Charge

    The state does run a veterans cemetery of its own, and it is at Grand Junction. It is easy to assume the only options here are the three national cemeteries, or to place the state cemetery at the veterans home in the south of the state — a separate burial ground that a different programme names.

  • Restoration of Honor Act — a Discharge Recognised Under State Law

    A less-than-honorable discharge is not automatically the end of state benefits here. Where the separation was for sexual orientation, gender identity or gender expression, the board can recognise the veteran under state law and the discharge stops being a bar to the listed state programmes. Guidance that reads the discharge character straight off the paperwork misses this route entirely.

    The status is state-only. It does not correct the federal record and does not create or remove federal entitlement, so a veteran seeking a federal discharge upgrade still has to pursue that separately. Reading the determination as a federal upgrade is the most likely misunderstanding.

  • Military Retired Pay — $15,000 Subtracted Under 55, a Different Rule After

    Turning 55 does not increase this subtraction — it ends it. The military retirement subtraction is written for retirees UNDER 55, and at 55 the general pension and annuity subtraction takes over. A retiree who keeps claiming the military line after their 55th birthday is on the wrong line, and one who assumes the benefit simply stops is also wrong.

    The $15,000 figure is not a step on a rising ladder. It climbed from $4,500 in 2019 to $15,000 in 2022 and has been flat ever since, with the department publishing the same $15,000 through tax year 2028. Guidance quoting $4,500, $7,500 or $10,000 is quoting a superseded year.

  • Veterans Mental Health Sessions — 26 a Year, but Only for Living Center Residents

    The name promises far more than the programme delivers. It is not open counselling for any veteran in the state: the enacted act limits it to veterans who live in a veterans community living center, and requires them to have used up their federally covered sessions first. A veteran reading the title alone would expect a state-funded therapy benefit and find a narrow top-up for nursing-home residents.

  • Military Funeral Honours Stipend — $75 for the First Service, $30 for the Next Four

    This is not a payment to a bereaved family and should never be described as one. It reimburses the organisation that fields the honour guard. The benefit to a family is that the honours happen.

  • Eight Veterans Courts, and a Sealing Rule That Outlives the Case

    Round-ups that describe a single statewide veterans court are wrong twice over. There are eight, run by different districts under different names — Veterans Trauma Court in one, Veterans Court in another, a two-track Veterans Treatment Court and Veterans Support Court in two more — and a veteran living outside those districts has none.

    The assumption that a bad paper discharge bars a veterans court does not hold here. The oldest court in the state publishes the opposite rule and explains why.

  • The Women Veterans Post Is Published — and Currently Vacant

    Directories that list a Colorado Women and Minority Veteran Coordinator as a live contact are repeating a page header. The page under that header says the position is vacant, and a woman veteran who rings expecting a specialist gets a general line.

  • No State Farming Programme for Veterans — the Page Is a Referral List

    Articles describing a state veteran farming programme here are usually describing a federally funded grant delivered by a local non-profit. The money is federal and the delivery is charitable; the state department’s role is the link.

  • The Surviving-Family Plate Is Called "Fallen", Not "Gold Star"

    The naming is the whole problem. Every national guide calls this benefit a Gold Star plate, the division calls it Fallen, and a grieving family searching the state's own site for the phrase they were told to use finds an empty result page.

  • The Parking Plate Needs Two Proofs — the VA Letter Is Only Half

    The plain Disabled Veteran plate and the Disabled Veteran Handicapped plate are different plates with different files. The first is a fee waiver on a rating; the second adds a clinical impairment test and buys the parking. A veteran who holds the first and assumes it parks is mistaken.

  • Winter Heating Help — No Veteran Route, and VA Benefits Count Against You

    Veteran-specific utility discounts mostly do not exist, and this state is a clear case. What exists is assistance that pays part of the bill on an income test — and the veteran's own compensation is counted in that income, which can push a household over the line rather than helping it under.

  • Short-Term Respite Stays — Booking a Bed at a State Veterans Home

    The state veterans homes are usually described as long-term care and nothing else, which hides the one thing a struggling family carer most needs: a bed for a fortnight. Respite is a stated offering at four of the five sites.

Connecticut

A first pass over Connecticut statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Primary Residence Exempt in Full — and From 2025 You Must Apply Every Year

    This record described the 2024 position under PA 24-46. PA 25-2 and PA 25-168 rewrote it, codified at CGS 12-81(83). The largest practical change is that the exemption must now be applied for every year by 1 January, where it previously was not.

  • Military Retirement Pay — Fully Subtracted, Survivors Included

    The booklet carves out a case the summaries omit: payments a FORMER SPOUSE receives under a final decree of divorce, dissolution, annulment or legal separation dividing military retired pay do NOT qualify for the exclusion. The former spouse pays state tax on that share even though the retiree would not.

  • 100% Tuition Waived for Every Wartime Veteran — 90 Days Is the Gate

    This waiver is regularly filed under "disabled veteran benefits." It has no disability element at all — any 90-day wartime veteran qualifies — and the practical caveat runs the other way: only TUITION is waived, and at community colleges where mandatory fees rival tuition, the waived share can be the smaller half of the bill.

  • Soldiers, Sailors and Marines Fund — Rent, Utilities, Medical, Funeral

    It pays mortgage interest, not mortgage principal. The fund’s not-covered list names payment of mortgage principal or purchase of real estate outright, so a veteran hoping to have a mortgage caught up will find only the interest portion in scope.

    It is not a debt fund. Payment of personal debts, credit card bills, past-due bills, loans or other obligations is on the not-covered list, as are taxes (sewer taxes included), insurance premiums, home repair or maintenance, telephone and cable bills, and the purchase of furniture, automobiles or other capital goods.

  • Serving Guard Members Get the Same Tuition Waiver as Wartime Veterans

    The certificate of eligibility gates registration, not billing. A member who leaves it until the bill arrives has already missed the step the system says must happen first.

  • Killed in Action Since 9/11, or Missing Since 1960 — Tuition Waived for the Family

    The two limbs do not share a date. Killed in action starts at 11 September 2001; missing in action or prisoner of war starts at 1 January 1960. Anyone told "post-9/11 only" has been given half the rule.

  • Five Points, Ten if Compensated — and the Spouse Route Most People Miss

    The ten-point bracket does not turn on how high the rating is. It turns on whether disability compensation or pension is payable at all — so a low but compensable rating sits in the same bracket as a high one.

  • Active Duty Buys Hunting, Fishing and Trapping at the Resident Rate

    There is no veteran discount here, and no disabled-veteran licence. The department’s free licences go to people who are blind, intellectually disabled, or who have permanently lost the use of a limb — a disability test with no service-connection element in it. A veteran with a high rating and four working limbs pays full price.

  • Military Relief Fund — up to $5,000 When Service Caused the Hardship

    This is a fund for people who are still serving and their families, not a veterans grant. A separated veteran in hardship should look instead at the Soldiers, Sailors and Marines Fund, which is published separately here and works on a different basis.

  • The State Burial Allowance Is $1,800 and Is Not a Veterans Programme

    A general burial allowance is often repeated as though it were a veterans benefit. It is not. It is means-tested social services law with a $1,800 ceiling, and it is recorded here as general-population law so it can never be counted as something service earned.

  • Treatment Instead of Trial — and the Charges Dismissed at the End

    This is not a veterans court, and calling it one misleads. It is a general diversionary programme with a veteran limb written into it, run by probation rather than by a dedicated docket — which is why it reaches every court in the state instead of a handful of districts.

    The discharge test here is wider than almost anything else in this state’s veteran law. Anyone told that an other-than-honorable discharge shuts them out of state veteran programmes should test that assumption against this one specifically.

  • A Label, a Map and Free Marketing Help for Farmer Veterans

    This is branding and marketing help, not capital. A farmer veteran reading a headline about a state programme for veteran farmers should know the department names no state loan, grant or land route on its own veteran farmer page — the loan routes it lists are federal.

  • The Flag on the Licence — Two Agencies, 30 Days, and $30 If You Cannot Wait

    This is a two-agency benefit and almost every summary describes it as one. A veteran who walks into a motor vehicle office with a DD214 and no prior verification has done none of the work, whatever the wait at the counter suggests.

  • Winter Shutoff Protection — There Is a Veteran Category, in the Statute

    Veteran benefit guides list a veteran receiving federal veterans benefits as a hardship category for utility shutoff protection in this state. The regulator's own current criteria, read this session, do not contain one. That does not mean a veteran is unprotected — it means the door is income and public assistance, and a guide that sends a veteran to the utility citing service alone sets them up to be refused.

  • Up to $7,500 a Year of Respite for a Dementia Carer

    This is not a veteran programme and no state page presents it as one. It matters to this corpus because the veteran population is ageing into dementia care, and the person who needs the help is the spouse or the adult child rather than the veteran — a different applicant, a different agency and a different form from anything a veterans office holds.

Delaware

A first pass over Delaware statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

District of Columbia

A first pass over District of Columbia statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Hawaii

A first pass over Hawaii statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Military Pensions Untaxed — Under General Pension Law

    This is not a veteran statute — Hawaii exempts employer-funded pensions generally, and the military pension rides that general law. The instructions name it as an example, which is why this record exists with is_veteran_specific false.

  • Preference Points in State Civil Service Exams

    The 10-point letter has a shelf life the summaries skip: the VA or armed-service statement must be dated within the past twelve months, so a years-old award letter earns only the 5-point tier until refreshed.

  • Motor Vehicle Exemption — $45 Off, Not the Whole Registration

    It is $45, not the registration. The office’s own example — a $245 bill becoming $200 — is the clearest statement of that anywhere in this corpus, and it is worth reading before budgeting around a full waiver.

    The DMV is the second stop, not the first. The exemption runs on a letter written by the veterans office after seeing your licence, registration and VA decision letter.

  • State Veterans Cemetery — Gravesite, Marker and Perpetual Care, No Reservations

    Gravesites cannot be reserved in advance. The cemetery says so outright, which makes it the opposite of the pre-registration model most state cemeteries use — there is nothing to file ahead of time and nothing that guarantees a place.

    Full military honours are provided for retirees only — uniformed pallbearers, a flag-folding detail, a rifle salute, a bugler and a chaplain. Other veterans are provided a bugler and a minimum two-person team to fold and present the flag.

  • Guard Tuition Assistance — Full Undergraduate Tuition, Paid Back to You

    The statute authorises undergraduate study only — "undergraduate students working toward a degree on any campus". The programme page offers 50% toward a first master’s degree. The extension is real and published by the office that runs it, but it rests on the adjutant general’s rules under §121-45(b) rather than on the statute, so confirm it for your own semester rather than assuming it.

    This is not a tuition waiver. You pay the campus, then submit end-of-course paperwork within 15 days of grades posting and are reimbursed. Anyone planning on the bill never arriving has the mechanism backwards.

  • Free Certified Copies for a Service Claim — A 1949 Statute Almost Nobody Cites

    This is not a general free-records benefit. The copy has to be "required for use in connection with a claim based on service in the armed forces". A birth certificate for a passport, a school or a driving licence is charged at the ordinary rate.

  • Hunting and Ocean Fishing — The Resident Rate While You Serve

    There is no disabled-veteran hunting or fishing concession in the statute. §183D-22(b)(4) makes the licence free to residents aged sixty-five or over and to residents of Kalaupapa with Hansen’s disease — and to nobody else. A rating of any percentage does not appear anywhere in the fee schedule. The concession here is for serving members, not for disability.

    The $10 wildlife conservation stamp survives the military rate. A serving hunter pays $10 for the licence and $10 for the stamp, so the annual outlay is $20, not $10.

  • Vehicle Weight Tax — One Car Exempt While You Serve

    The section’s heading says "claiming Hawaii as their residence of record". Its text says no such thing — the two conditions are assignment to a unit in the State and good standing. A member stationed here who kept another state as their residence of record still meets what the section actually requires.

  • Veteran-Owned Business Preference — There Is None in the Procurement Code

    This is an absence established from the enumerating provision, not a failure to find something. Part X of the code names each preference it creates, the office that administers procurement publishes the same list, and neither contains a veteran. That is a stronger finding than silence.

  • University Tuition — The Non-Resident Differential Removed, Not Residency Granted

    This is not residency. HRS §304A-402 still sets the basic rule — twelve consecutive months’ bona fide residence before the first day of instruction, or graduation from a high school here within the preceding two years. The exemption removes the price difference without making anyone a resident, which matters for anything else that turns on residency.

    The exemption survives a transfer out. A continuing student who qualified as an authorised dependant keeps the exemption from the non-resident differential when the service member is transferred out of the State on military orders. Families who assume a permanent change of station ends it have re-priced a degree for no reason.

  • Ending a Lease on State Active Duty — Housing and the Car, by Written Notice

    This is not the federal Servicemembers Civil Relief Act and it is not a state copy of it. §657D-1 limits "military service" to state active duty in the state military forces and to full-time National Guard duty. Someone on federal active duty uses the federal act, whose lease provision turns on permanent change of station and deployment orders — a different trigger from this one, which turns simply on entering service after the lease was signed.

  • A VA Letter Skips the Doctor’s Form — but It Must Be One Disability at 40%

    Summaries that say "a veteran rated 40% or higher qualifies" drop the word that decides it. The test is a SINGLE disability at 40% or greater. Combined ratings are how veterans think about their ratings and are not how this card is issued.

  • A Veterans Court on Two Islands, Sitting Every Friday

    This is a two-island programme, not a statewide one. A veteran charged on Maui, Kauai or Molokai has no veterans docket on the published position, and any guide implying statewide coverage is overstating it.

  • Eight Ways Into the State Farm Loan, and Service Is Not One

    Veteran farming guides that list state agricultural loan programmes as veteran resources are describing a door that is open to everyone and shaped for nobody in uniform. Reading the definition is what saves the wasted application.

  • Gold Star Family Plates — Grandparents Named In, and a Front Plate Kept as a Memorial

    The plate is not free here. Guides that list gold star plates as a no-cost benefit are generalising from other jurisdictions; the operative words in this section are "shall provide, for a fee".

  • Kupuna Care Absorbed the Caregivers Programme — and the $210 a Week Left the Statute With It

    The $210-a-week kupuna caregivers allocation is quoted in guides published years after the section that carried it was repealed. Anybody budgeting on that number is budgeting on a repealed statute. The successor programme has no cap in its text — which cuts both ways, because it also has no floor.

  • The Placard Is Decided by a State Board, Not the County — and Needs a Six-Year Prognosis

    A disabled veteran registration concession and a parking permit are different things decided by different offices on different tests. A veteran holding the registration fee exemption for a total service-connected disability has no parking entitlement flowing from it.

Idaho

A first pass over Idaho statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Retirement Benefits Deduction — Military Pensions at 65, or 62 Disabled

    This is not a veteran-specific exemption and it is not unlimited: CSRS and FSRDS civil pensions and certain police and firefighter pensions qualify on identical terms, the cap binds, and Social Security received eats the cap dollar for dollar. Summaries that say the state "exempts military retirement" are describing this capped, age-gated, offset deduction.

  • Five or Ten Points — at Every Public Employer in Idaho, Not Just the State

    The interview at 30% is not the same as the points, and it is the part most easily missed. It is conditional on the score placing you on the hiring list, and the hiring list is itself a subset — the top twenty-five on the register plus everyone tied at twenty-fifth.

  • Veterans Services Emergency Assistance — $1,500, and That Is the Lifetime Total

    The six-month rule is not a renewal. $1,500 is the lifetime total for the veteran and their dependents combined, so a household that draws the full amount once has exhausted the programme. Waiting out six months adds nothing.

    There is no five-year residency test and no requirement to have entered the service from this state, whatever the secondary guides say. The policy asks for a bona fide resident: a principal or primary place of abode here at the time of application, with the present intent to remain and to return after any absence.

    The Veterans Support Fund is a different thing and will not pay your rent. Established by Idaho Code §65-209, it funds projects that benefit veterans — outreach, training, equipment, ceremonies — with grants no greater than $5,000, and the division states that Veterans Support Funds are not provided to support the basic needs of individual veterans or their families.

  • A $5 Hunting and Fishing Licence at 40%, With Tags to Match

    The gate is 40%, not 50% and not 100%. Most recreation concessions in this corpus open higher, so a veteran at 40% or 50% who assumes they are outside this one is leaving several hundred dollars a season on the table.

  • Five Free Big Game Tags a Year, Once in a Lifetime, Apply in January

    This is not the cheap licence. Anyone rated 40% or more can buy the $5 disabled veteran licence every year; this tag is a five-a-year lottery decided by a committee, and winning it once ends eligibility permanently.

  • Gold Star Parents and Spouses Pay No Plate Fee — and the Licence Designation Is Free

    The Gold Star plate fee waiver is narrow. It is published for surviving spouses and parents; other immediate family can hold the plate but pay for it, with part of the fee going to veterans programmes.

    The waiver reaches STEPPARENTS as well as parents. §49-403B(4) names the spouse, parent or stepparent. Summaries that stop at "spouses and parents" leave a stepparent paying $35 to start and $25 a year for a plate the subsection gives them free.

  • The Women Veterans Page Is a Federal Signpost, Not a State Programme

    Directories that list a state women veterans programme here are counting a web page. The services on that page belong to the federal health system, and the state contribution is the link — which matters, because a woman veteran who is not enrolled federally gets nothing from any of it.

  • The Disability Placard Pays for Itself at the Meter — and a VA Rating Does Not Get You One

    A disabled veteran plate is ordered on its own form and proves a service-connected disability finding. The parking placard is ordered on ITD 3392 and proves a mobility disability certified by a clinician. Holding the first does not produce the second, and the department publishes separate order forms for exactly that reason.

Iowa

A first pass over Iowa statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • The Whole Levy, Credited

    The acreage rules change for applications from July 1, 2026 — from up to 40 rural acres down to a half-acre. A rural veteran who has not yet filed should file before the change.

  • $7 Lifetime Hunting and Fishing Licence

    The gate is compensation, not percentage: county veterans affairs guidance states that a 0% compensable rating qualifies, as long as the VA pays monthly. A veteran waiting to hit some threshold is waiting for nothing.

  • Absolute Preference, Written Reasons, and Three Ways to Enforce It

    The headline mechanism is not points. §35C.1 gives preference in appointment and employment over other applicants "of no greater qualifications" — an absolute preference on equal footing, reaching every public department, all public works, and the counties, cities and school corporations alike. Points enter only where a point-rated qualifying examination is used, and then by reference to §400.10.

  • War Orphans Educational Assistance

    The citation in circulation — Iowa Code §35.9, with a $5,500-per-year figure — is dead law: §35.9 was repealed by 2012 Acts ch 1059, and the current §35A.13(9) sets the post-9/11 cap at the highest regents resident undergraduate tuition rate per year (less other aid, within need), not a fixed dollar amount. The pre-9/11 tier's $600/$3,000 caps survive unchanged.

  • Professional Licence Fees Waived — Initial and One Renewal, Within Five Years of Discharge

    This is routinely described as "licence fees waived for veterans", which reads as permanent. The statute waives an initial application fee and exactly one renewal fee, and only where the fee would be charged within five years of discharge. After that the veteran pays what everyone pays.

  • State Veterans Home — No Out-of-Pocket Cost at a 70% Rating With Nursing Need

    The no-cost statement has two conditions, not one. The admissions page ties it to a veteran rated 70% or higher AND in need of NURSING care. Residential care at the same rating is not described that way, and the cost page — which is where the charge is actually explained — does not repeat the 70% rule at all.

  • Targeted Small Business — a 40% Share of the State’s Small-Business Procurement Goal

    The 40% figure is widely quoted as if agencies must place 40% of their purchasing with service-disabled veteran-owned firms. Read in place, §73.16(2)(d) sets it as a share of the TARGETED SMALL BUSINESS goal — a goal within a goal. It is a real target, and it is a fraction of a fraction of state spending.

  • Veterans Trust Fund — Fifteen Named Bills It Can Pay, Including Rent Application Fees

    This is commonly described as an emergency fund for veterans in crisis, which makes it sound open-ended. It is not: §35A.13(8) is a closed list of fifteen purposes, and a bill that does not fall inside one of them cannot be paid however urgent it is.

    The department’s own summary of what the fund currently pays is NARROWER than the statute. It names unemployment or underemployment assistance, vision, hearing and dental care, durable medical equipment, prescription drugs, counselling and substance abuse services, vehicle repairs, housing repair and transitional housing. Honour guard services, trauma ambulance costs, rental application fees and the $1,000 homelessness payment are all in the statute but absent from that summary — so ask, rather than assuming a statutory purpose is live this year.

  • Injured Veterans Grant — $2,500 Every Thirty Days, Up to $10,000, So Family Can Be There

    This is usually written up as "up to $10,000 for seriously injured veterans", which reads like a single cheque. It is not: the statute pays in $2,500 increments at thirty-day intervals, and it stops when the veteran stops being hospitalised or receiving military-authorised care. A veteran who recovers in six weeks receives a fraction of the headline figure.

  • County Relief for an Indigent Veteran — Food, Shelter, Utilities, Medical and a Funeral

    County veteran relief is usually described as help with claims paperwork. That is §35B.6. §35B.14 is separate and is actual money: the board of supervisors may appropriate for food, clothing, shelter, utilities, medical benefits and a funeral. Veterans who only ever hear about the claims office never learn the relief exists.

  • National Guard Service Scholarship — Never Less Than Half the Regents Tuition Rate

    This programme is routinely written up as "free tuition for the Iowa National Guard". The section does not promise full tuition. It promises a band — no more than the regents resident rate, no less than half of the lower of that rate and the rate actually charged — and it lets the adjutant general ration awards when the appropriation runs short.

    It moved. The programme was Iowa Code §261.86 until the 2024 recodification and is now §256.210. A search for the old number returns nothing on the legislature’s own server, which is how the programme comes to look repealed when it is not.

  • The Recorder Files Your Discharge Free — and Certified Copies Are Free When a Claim Needs Them

    The usual summary is "Iowa counties record a DD214 for free". Subsection 7 is the part that gets missed and is worth more: where a CERTIFIED copy is required to perfect the claim of a veteran or a dependant, the custodian must furnish it without charge. That is a standing fee waiver on the document a claim actually needs, not just on the filing.

  • A Car the Government Bought You Registers Free — Plus One Free Set of Plates

    Iowa is often listed as having no disabled-veteran registration exemption at all. It has one, but it is narrower than most: it follows the federal automobile GRANT rather than a disability percentage, so a 100% rated veteran who bought their own car is outside it while a lower-rated veteran who received a granted vehicle is inside it.

  • Break the Lease on Orders — House or Car, and the Dependant Walks Free Too

    This is usually written up as "Iowa follows the federal SCRA". It does not merely follow it. Two provisions here go further than the federal act: the termination expressly extinguishes any obligation a DEPENDANT has under the same lease, and the ban on a vehicle-lease early termination charge is stated flatly rather than left to the lessor’s schedule.

    The definition section is the trap, and almost every summary of this provision misses it. §29A.90 says that as used in this subchapter, "service member" means a member of the MILITARY FORCES OF THE STATE performing military service, and "military service" means full-time national guard duty or state active duty as defined in §29A.1, for a period of at least thirty consecutive days, commencing on or after 12 April 2012. A regular-component member on federal Title 10 orders is therefore outside the state provision and must rely on the federal act, notwithstanding that §29A.101A itself talks the language of permanent change of station and deployment.

    The effective date is the thing people get wrong. On a monthly premises lease it is thirty days after the first date the next rental payment becomes due and payable after delivery of the notice — which for a notice served mid-month means you are usually paying one more full month, not walking out in thirty days.

  • No Eviction, No Repossession, No Foreclosure Without a Judge — and a Rent Ceiling of $1,200

    The $1,200 is widely quoted as though it were a benefit amount. It is a ceiling, and it works against the tenant: at or above $1,200 a month the flat bar in subsection 1 falls away and you are left with the court’s discretionary stay. Anyone repeating it as "Iowa pays $1,200" has read it backwards.

    The penalties are not symmetrical, and that matters when you are deciding what to put in a letter. Taking part in an eviction outside §29A.101 is a SIMPLE misdemeanor; knowingly repossessing under §29A.102 or foreclosing under §29A.103 is a SERIOUS misdemeanor.

    These sections are constantly described as a state version of the federal act available to any servicemember. §29A.90 says otherwise: as used in this subchapter, "military service" means full-time national guard duty or state active duty as defined in §29A.1, for at least thirty consecutive days, commencing on or after 12 April 2012, and "service member" means a member of the military forces of the state performing that service. A member on federal Title 10 orders looks to the federal act instead.

  • A Veteran’s Benefit Is Exempt From Execution — With No Dollar Cap Written Beside It

    Summaries of exempt property in this state routinely fold paragraph (b) into a general "pensions and benefits, to the extent reasonably necessary" line. Read on the page, the limiter belongs to paragraph (d) only. Paragraph (b) is four words long — "a veteran’s benefit" — with nothing qualifying it.

  • A Grave Marker From the County — and Treble Damages If Somebody Takes It

    The marker section and the burial section are constantly run together. They are different in the one way that matters: §35B.14 makes the commission RESPONSIBLE for interring a veteran who died without sufficient means, while §35B.16 says the commission MAY furnish a marker. One is a duty, the other is a discretion.

    The neighbouring section on maintaining graves is gone. §35B.17, "Maintenance of graves", was repealed by 2024 Acts, ch 1047, §11, and §35B.15 was repealed in 2014 and folded into §35B.14. Guides still citing either number are citing repealed law.

  • Reopen a Default Judgment — and Nobody May Downgrade Your Credit for Asking

    This subchapter is habitually described as "Iowa’s version of the federal Servicemembers Civil Relief Act", which invites a federally activated veteran to rely on it and a state-status Guard member to ignore it. Read the definitions: §29A.90(3) defines "military service" as full-time national guard duty or STATE ACTIVE DUTY of at least thirty consecutive days beginning on or after 12 April 2012, §29A.90(4) defines "service member" as a member of the military forces of the STATE, and §29A.91(2) says in terms that the subchapter does not apply to duty performed under orders issued pursuant to 10 U.S.C. It is the state-status counterpart to the federal act, not a copy of it — and it fills the exact gap the federal act leaves open.

    The thirty-day figure is widely quoted as a grace period after discharge during which creditors must leave you alone. It is not. §29A.91(3) suspends or postpones action until thirty days after discharge only on PROPER APPLICATION, and §29A.92 makes thirty days after service ends the DEADLINE for moving against a default judgment. Nothing happens automatically; the clock runs against you, not for you.

  • Deployment Is Not a Custody Argument — and Nobody Gets a Permanent Order While You Are Gone

    Guides still cite Iowa Code §598.41D for the deployed parent’s right to assign visitation to a family member. That section was REPEALED by 2016 Acts, ch 1084, §30 and replaced by chapter 598C. Citing the repealed number in a filing invites a court to disregard the whole argument; the delegation power now lives at §598C.305 and §598C.306.

    The protection is often summarised as "deployment can never be considered in a custody case". §598C.107 is narrower and more precise: the court may not consider past or probable future deployment IN GENERAL. Specific, concrete effects of a particular absence on a particular child remain open to argument, which is why the agreement route in article II is worth taking.

  • Your Job Is Held, Your Seniority Is Not Frozen — and the Civil Air Patrol Is Inside It

    This is routinely folded into "the federal USERRA covers that anyway". It does not cover all of it. §29A.43 names the CIVIL AIR PATROL alongside the guard, the organized reserves and the coast guard in regular, reserve and auxiliary components — civil air patrol duty performed under §29A.3A is not federal uniformed service, so a member relying only on the federal statute has no reinstatement right at all.

  • The County Keeps a Permanent Record of Where Every Veteran Is Buried

    Two nearby sections are commonly cited for grave upkeep and are gone. §35B.17, "Maintenance of graves", was repealed by 2024 Acts, ch 1047, §11, and §35B.18, "Payment — how made", was repealed by 2014 Acts, ch 1116, §54. What survives in this part of the chapter is the RECORD at §35B.19 and the marker at §35B.16 — not a standing statutory duty to maintain the grave itself.

  • No Veterans Treatment Court Sits in the Iowa Code — What Exists Is a Judge’s Docket

    Guides that list a "veterans treatment court" among Iowa state benefits are describing a bill. The section it would have created, §602.7301, is not in the Iowa Code 2026, and §602.6306(2) was read in full to confirm the jurisdiction grant never landed.

  • The Beginning Farmer Tax Credit Has No Veteran Route — and the Rules Left the Word Behind

    The programme is often written up as help for the beginning farmer. It is a credit against the LANDOWNER’s Iowa income tax. A veteran reading it as a grant to start farming will apply for the wrong thing.

  • County Veteran Relief Does Not Cover the Ride — Transport Is Not on the Statutory List

    The published record ‘ia-county-veteran-relief’ sets out what §35B.14 does cover. This record records what it does not: the list is closed on its face, and transport is outside it. A veteran told the county "has to" provide a ride is being told something the chapter does not say.

  • Parking Placard on a VA Certification — With a Self-Certification the Statute Does Not Mention

    A disabled veteran plate and a parking placard are different things with different tests. The plate route in §321.166(6) turns on the federal government having provided or assisted in providing the vehicle; the placard turns on mobility. Neither one issues the other.

  • Deployment Stops the Shutoff — Gas and Electric, Through Deployment Plus 90 Days

    There is no veteran discount on a utility bill in this state. What exists is a shutoff shield tied to a live deployment, and separately a trust fund that can pay a bill. Anybody promising a percentage off a gas or electric bill for having served is describing something that is not in the commission's rules.

Kansas

A first pass over Kansas statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • An Interview You Cannot Be Denied on a Flagged Vacancy

    There are no preference points here. The administering office describes the benefit as an offered interview and consideration — and says plainly that preference does not place a veteran in every vacancy, because that would be incompatible with the merit principles the civil service rests on. A veteran expecting a numeric bump will not find one.

  • Military Service Scholarship — the Hostile-Fire-Pay Test

    This is not a blanket veteran scholarship: the statutory gate is geographic and fiscal — service in international waters or on foreign soil, in operations for which hostile fire pay was received, for 90 days after 11 September 2001 — and an injury that cut the deployment short satisfies the 90-day test rather than defeating it.

  • Occupational Licence in 15 Days — and Every Fee Waived for a Military Spouse

    The fee exemption and the fast timeline are two different benefits with two different populations. The 15-day decision reaches servicemembers, veterans with an honorable discharge, and spouses. The blanket fee exemption reaches only spouses of ACTIVE duty members — a veteran claiming it will be charged.

  • Soldiers’ Home — Two Years’ Residency, and Priority for Those Without Means

    Summaries of state veterans homes usually lead with the discharge and the medical need. Here the binding condition for many applicants is neither: it is two years of actual residency immediately before application, with no exception written into the section.

  • Disabled Veteran Business — a 3% Contracting Goal, at a 30% Rating

    The federal service-disabled veteran-owned test needs only a service-connected disability. This one needs an evaluation of 30% or more. A veteran certified federally at 10% or 20% will not qualify here on the same paperwork.

  • Permanent Hunting and Fishing Licence, Free, From 30%

    The threshold here is 30%, not the 50% this state uses for the disabled veteran licence plate. Two different statutes, two different numbers, and a veteran rated 30% to 40% who was told they do not qualify for the plate may still have this licence.

  • Registration and Plate Free at 50% — and Metered Parking With It

    The caregiver plate is routinely described as though it carries the same waiver. It does not: a resident responsible for transporting a disabled veteran may apply for the plate "with no fee in addition to the regular registration fee" — the registration itself is still charged. Only the veteran’s own registration is free.

    Free metered parking does not require the accessibility symbol. A plate without the symbol still parks at meters without charge; the symbol adds the designated accessible spaces. Veterans who assume they need a separate disability placard for meters are paying twice.

  • Guard Educational Assistance — Tuition and Fees Paid, With Twenty-Four More Months Owed

    This programme is regularly written up as "100% of tuition and fees for the Kansas National Guard". The Board of Regents’ own sheet does not promise that. It says the programme provides "a percentage of tuition and fees", and that the percentage is determined by the number of eligible students and available appropriations. Treat a full award as the best case, not the baseline.

    The older Kansas National Guard statute at K.S.A. 48-1901 was REPEALED in 2011. Anyone searching chapter 48 for the educational assistance act will find nothing; it lives at K.S.A. 74-32,145 et seq. under the Board of Regents.

  • Free Vital Records for a VA Claim — and the First Five Discharge Copies Free Too

    The waiver is not "free vital records for veterans". It is purpose-tested and evidence-tested: the applicant must EXHIBIT correspondence from the VA or the Kansas Office of Veterans Services showing a benefit application and the need for the record. A veteran ordering a birth certificate for any other reason pays the normal fee.

  • The State Cemetery System — Built Only on 100% Federal Money, by Statutory Design

    The interesting content of this section is a CONSTRAINT, not a benefit. The director may not enter a construction contract unless the federal government provides an amount equal to one hundred percent of the construction cost, and may make no more than three applications to the Veterans Administration for cemetery grants after the act took effect. Kansas built its cemetery system on federal money by statutory design, which is why expansion is not simply a budget question.

  • The County Must Bury a Veteran Who Dies Without Means — and Not in the Pauper Ground

    This is widely summarised as "Kansas counties must bury any indigent veteran". Read the list. K.S.A. 73-304 names the Spanish-American war, the Philippine insurrection, the expedition to China, world war I, world war II, and operations in Korea or other places under the flags of the United States and the United Nations or under the flag of the United States alone. Vietnam, the Gulf, Iraq and Afghanistan are not named, and neither is peacetime service. A family relying on this section for a recently deceased veteran should raise that with the county before assuming the duty is owed.

    The headstone is a weaker right than the burial. K.S.A. 73-302 caps a headstone at twenty dollars — a figure from 1885 that has never been raised — and the Attorney General opinion printed beside the section, 96-63, is summarised there as holding that a county is AUTHORIZED but NOT REQUIRED to provide a marker under K.S.A. 19-101a. Treat the marker as something to ask for, not something to demand.

  • Military Funeral Honours at No Cost — Flag Folded, Taps Sounded, Volleys If You Ask

    Families are often told the honours must be arranged with the veterans office or with the national cemetery. They are not: the request runs from the family to the FUNERAL DIRECTOR and from the funeral director to the honours office. A family that telephones the wrong office loses days it does not have.

    An "other than honorable" discharge is frequently assumed to end the matter. The programme states the standard as discharge under conditions other than DISHONORABLE, which is a different and wider test. It is worth putting the question to the honours office rather than deciding it at the kitchen table.

  • Fifteen Days’ Notice on Orders — But Only on a Periodic Tenancy

    These two sections are regularly listed as "Kansas lets a servicemember break a lease on orders". They do not. Both operate on PERIODIC tenancies, and K.S.A. 58-2570(b) says in terms that a rental agreement for a definite term of more than thirty days shall not be construed as a month-to-month tenancy even where rent is payable at thirty-day intervals. A twelve-month lease is outside both sections; the route there is the federal Servicemembers Civil Relief Act, not state law.

    The tense matters. The words are "is in the military service of the United States" — present, at the time notice is given. A veteran who has already separated and is moving for a civilian job is not inside these sections at all, however recently they served.

  • Deployment Is Not, By Itself, a Change in Circumstances — and the Burden Shifts on Your Return

    Older references send readers to K.S.A. 60-1630 for this protection. The Revisor’s note on the current section records 60-1630 as the source or prior law: the provision was re-enacted at K.S.A. 23-3217 by L. 2008, ch. 151, § 1 and moved into the family law chapter. Citing the old number invites an argument you do not need to have.

    The section is often read as banning any change of custody during a deployment. It does not. It bars the absence from being, BY ITSELF, a material change of circumstances warranting a PERMANENT modification — and subsection (h) preserves the other parent’s right to petition on a genuine material change. What the section guarantees is that the deployment alone will not carry the argument.

  • Federal Pension Money Is Shielded From Garnishment — Three Months of It, and Only on an Affidavit

    This is habitually listed as "Kansas exempts veterans’ benefits from garnishment", full stop. Subsection (a) is far narrower than that on its face: it reaches money received in the THREE MONTHS before the process issued, it is conditional on the money being necessary for maintenance, and it does nothing at all until the debtor files an affidavit or makes proof. An exemption that has to be claimed is not the same as one that runs automatically.

    The words in the statute are "pensioner of the United States", not "veteran". The section is therefore both wider than veterans in one direction and, on its face, silent on how it treats compensation paid for a service-connected disability as distinct from a pension. Anyone relying on it for disability compensation should get that question answered in the proceeding rather than assumed.

  • Tuition and Fees Waived for the Child of a Prisoner of War or a Person Missing in Action

    The waiver is regularly described as a state scholarship that a student applies for at the college. It is not a scholarship and the college does not decide it: the institution has a statutory DUTY to enrol the dependent without charge, and the director of the Kansas Office of Veterans Services decides who qualifies. A student turned away at an admissions desk is being told the wrong thing by the wrong office.

    Families sometimes assume the entitlement dies when the parent comes home or is finally declared dead. The section says the opposite in terms: once a person qualifies as a dependent, no occurrence such as the return of the parent or the parent’s reported death disqualifies them.

  • Finish the Specialty Court Programme and the Sentence May Be Reduced — Though the Statute Never Says "Veteran"

    Kansas veterans treatment courts have no statute of their own. K.S.A. 20-173 was read in full and does not contain the word veteran; the authority is the Supreme Court’s rulemaking power in subsection (a), exercised through Rule 191. Anyone citing a Kansas "veterans treatment court act" is citing something that does not exist.

  • Gold Star Mother Plates — Mothers Only, and the Ordinary Fee Still Applies

    Guides that list a "Gold Star Family plate" here are describing something the chapter does not contain. The only gold star provision is 8-177d, and it names the mother. A surviving spouse of a servicemember who died on active duty has no gold star plate to apply for in this state.

    It is also not free. The neighbouring plate sections show the drafter knows how to say "no fee or charge" and how to say "free"; 8-177d says neither, and instead points at the ordinary fee section.

  • The Placard Needs a Clinician, Not a Rating — and the Identification Card Must Be in the Car

    A VA rating letter, however high the percentage, is not a certifying statement under 8-1,125. The list of who may sign is closed and clinical. Veterans routinely arrive at the counter with the wrong document and are turned away.

  • In-Home Services at 60 — No Veteran Door, and Paid Only After Everything Else

    There is no state-funded caregiver stipend for a veteran's family member in this act. The programme buys services for the older person; it does not pay a relative to provide them, and it carries no service-related route in or up.

Kentucky

A first pass over Kentucky statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • $49,100 Off — General Disability Law

    This is not a veteran statute — it is Kentucky’s general disability/age homestead law, and a totally disabled veteran claims through the VA classification. Veteran-benefit lists that present it as a veteran exemption have the shape wrong.

  • Tuition Waived for a Deceased Veteran's Spouse and Children

    This waiver is routinely summarized as being for families of veterans who "died in service or of service causes." The statute's first route is wider: wartime-era service alone qualifies the family — a veteran who served during a declared war or national emergency and later died of ANY cause leaves an eligible spouse and children, provided the Kentucky residency root and honorable-conditions tests hold.

  • Licence Frozen in Good Standing on Active Duty — No Dues, No Fees, No CE

    The CE waiver is not automatic in both of its branches. Where military duty merely prevented the training, the statute requires a waiver request to have been submitted to the board. Only the second branch — performing the occupation as part of military duties, annotated on the DD 214 — needs no request.

  • Military Training Toward a Licence — Permissive, and a Two-Year Clock

    This is often listed as "military training counts toward licensure". The section says a body "may issue" — and then says nothing in it "shall require" a body to issue where it judges the training insufficient. It is a door a board may open, not one a veteran can push through.

  • State Veterans Nursing Homes — Residency at Admission, and No Charge on the Federal 70% Route

    Most state veterans homes admit spouses, and many summaries assume this one does. The current eligibility regulation defines a resident as a veteran of this Commonwealth admitted to a state veterans’ nursing facility, and contains no spouse or Gold Star provision at all. The older admission regulation, 17 KAR 3:040, has expired.

  • Indigent Veterans’ Burial — $1,000 Towards the Funeral, Paid to Whoever Bore It

    The statute is broader than the money. KRS 40.355(2) says the fund pays for the burial or cremation AND BURIAL HONORS of an indigent veteran — honours are inside the programme, not an extra. The $1,000 ceiling comes from the regulation, not from the statute, which sets no figure at all.

  • Veterans’ Personal Loan — $10,000 From a State Trust Fund, Including for Debt Consolidation

    This is frequently listed among state veteran BENEFITS without saying that it is a loan. It is a loan: the fund executes instruments, collects principal and interest, may take a real estate mortgage, and may sue. Nothing here is forgiven, and the fund may write off only what it considers uncollectible on its own initiative.

  • National Guard Tuition Award — Up to $50,000 in a Lifetime, and It Depends Which Campus

    This is widely described as "free tuition for the Kentucky National Guard". Two limits are usually left out. There is a LIFETIME dollar cap that depends on which campus you attend — $20,000 at KCTCS against $50,000 at UK or U of L — and the private-institution route is switched off by statute until the Department of Military Affairs tuition assistance appropriation is first fully funded.

  • State Hiring: an Interview You Cannot Be Refused — Not Points on a Score

    Kentucky is repeatedly listed as giving veterans five preference points on a merit examination and disabled veterans ten. The statute on the books says nothing of the kind. KRS 18A.150 is titled "Interview preference" and it grants an interview, not points; there is no scoring provision anywhere in the section, and no separate disabled-veteran tier. Anyone planning around a points bump for a Kentucky classified job is planning around a benefit the current statute does not contain.

  • The County Clerk Records Your DD214 Free — and Will Destroy It on Fifteen Days’ Notice

    The free part is the RECORDING, not the copies. Subsection (1) says the clerk shall record the papers "without charge therefor"; nothing in the section makes a later certified copy free. Kentucky differs from states that waive both, and a veteran told the copies are free may be surprised at the counter.

  • No City or County Vehicle Fee — and Two Extra Hours at the Meter

    This is not a state registration exemption and should not be read as one. It bars CITIES AND COUNTIES from charging a vehicle licence or fee; the state registration fee sits elsewhere and is untouched by this section.

  • State Veterans’ Cemeteries — Guard and Reserve Members Are In By Name Since 1 January 2026

    This corpus carried the cemeteries as an unresolved candidate because the department’s own site is edge-blocked. The statute was reachable the whole time under a different id. The lesson is specific to this state: a stale statute id on apps.legislature.ky.gov redirects to InvalidStatute.aspx, and the statuteRsn in that redirect is the CURRENT id — 40.315 lives at 56650, not at the 21847 the old sequence implies.

    The Guard and Reserve route is new and is routinely missing from write-ups, which still describe eligibility as simply "the same as a national cemetery". The version effective 1 January 2026 adds a whole second path for reserve component and National Guard members who would not clear 38 U.S.C. §2402, and a further limb for those who died on state active duty or under Title 32.

  • The Homeless Veterans Programme — Addiction Treatment, Housing and Work, and It Reaches the Merely Threatened

    The programme is generally described as a homelessness service. Subsection (2) is broader on its face: prevention of the THREAT of homelessness and its causes is part of the mission, and subsection (4) extends assistance to persons whose need arises from other circumstances prescribed by regulation. A veteran turned away because they still have a tenancy has been read the wrong subsection.

  • The Wounded or Disabled Veterans Programme — a Coordinator, and Data-Sharing With the VA and Defense

    The programme is easy to mistake for an advisory body because most of the section reads as review and recommendation. The operative duty is in subsection (1)(b)2 and it is not advisory: the programme shall ensure that wounded or disabled veterans receive the benefits to which they are entitled.

  • Military Funeral Honors: the State Pays the Detail up to $100 — and the Family May Not Be Charged

    The figure repeated in most write-ups of this programme is a $60 maximum, on a scale topping out at $60 for a rifle team with a live bugler. That is the superseded schedule, and an automated read of the regulation page still returns it. The text in force since 18 November 2024 caps the stipend at $100 and pays $15, $30, $50, $80 and $100 up the scale. A family or an organisation budgeting against $60 is working from the old law.

    This is not money the family receives, and it should not appear as a line on a funeral invoice. Section 4(3) makes it a condition of the stipend that the organisation does not receive an honorarium, donation or other payment from the funeral home or the veteran’s family for the honours provided. Honours being billed to you by an organisation that also claims the state stipend is worth raising with the department.

  • Servicemembers Civil Relief, Extended to Title 32 and State Active Duty — at Thirty Days

    The common assumption is that a Guard member on duty is covered by the federal Servicemembers Civil Relief Act whatever the orders say. That is not how the federal Act is built — its protections attach to federal service, and duty performed under Title 32 or on state active duty falls outside it. KRS 38.510 exists precisely because of that gap. A Guard member activated by the Governor who is told the federal Act does not apply to them is being told something correct about federal law and something incomplete about their position here.

  • Guard Leave, Reinstatement, and a Ban on Squeezing You Out — but Not a Day of It Paid

    This is regularly listed as "paid military leave for the National Guard" here. The section says the opposite in terms: the employee shall be permitted to return with the same seniority, status and pay, "except that no employer shall be required to grant an employee a leave of absence with pay". The protection is the job and the seniority, not the wages during the absence.

  • Injured on State Active Duty: Paid Status Continues at Your Regular Rate — Offset by Other Disability Income

    This is not a lump-sum disability award, and it should not be filed alongside the fixed state payments other jurisdictions make to their Guard. It is continued PAY at the member’s own regular active duty rate, discretionary, and offset pound for pound by workers’ compensation, Social Security and other public disability income. Someone told they will receive a set state disability sum for a state-duty injury here is being told about a benefit this section does not create.

  • A Women Veterans Programme in Statute, With a Coordinator the Commissioner Must Designate

    The programme is not a benefit that pays. It is outreach, advocacy and guided application help, plus a statutory channel for complaints about how women veterans are treated. Expecting a cheque from KRS 40.600 will disappoint.

  • Two Gold Star Plates Free — For a Mother, a Father or a Spouse, and Not for a Sibling or Child

    Five Gold Star plate categories exist; only three of them are free. KRS 186.041(6) names Mothers, Fathers and Spouses. The Siblings plate and the Sons or Daughters plate were added through KRS 186.164(16)(a) and the free-of-charge subsection was not widened to reach them, so a bereaved brother or daughter should expect to pay.

  • The Word "Veteran" on Your Licence — At Initial Application, Renewal or Duplicate

    A general under honorable conditions discharge is expressly inside this subsection. That is worth knowing because it is not true of every state credential programme, and a veteran with a general discharge is often told at the counter to expect a refusal.

  • Accessible Parking Turns on Walking, Not on a Rating — Plus Two Extra Hours at the Kerb

    A service-connected rating is not an accessible parking plate. KRS 186.042 does not mention veterans, disability rating or the federal veterans department at all. A veteran rated 100% for a condition that does not impair walking is outside it; a veteran rated 30% who cannot walk 200 feet is inside it.

  • No Veteran Shutoff Rule — But a Winter Regime a VA Pension Household Can Use

    There is no Kentucky veteran utility discount, and no veteran shutoff bar. The regulation that decides these questions was searched in full for "veteran" and "military" and contains neither word. What a veteran household actually has is the same income-based regime as every other household — which is worth knowing before spending an afternoon looking for a rate that does not exist.

Louisiana

A first pass over Louisiana statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Three Tiers to a Full Exemption

    Guidance written before 2023 shows only a double homestead exemption for 100% veterans. The 2022 amendment (effective 2023) created the three-tier structure and added the unemployability route to the full tier.

  • Five or Ten Points on the Score — and a Route Around the Test Entirely

    The open question here was whether the constitutional five/ten point preference still operates now that most hiring is unassembled. It does, but conditionally: Rule 22.7 attaches the points to a "final examination score", and Rule 22.6 defines examination broadly enough to include experience and training evaluations, resume evaluations, structured orals and job interviews. Where a vacancy is filled with no scored assessment at all, there is no score for the points to attach to — and that is exactly the gap Rule 22.8(d) fills for the recently discharged.

  • War Veterans Homes — Free at 70%, $2,424 a Month Below It

    The homes are usually described as a family benefit. They are — but the price is not the same benefit. A spouse or Gold Star parent is charged $5,500 a month, more than twice the $2,424 a veteran below 70% pays, and there is no rating route to reduce it.

  • Veteran Initiative — 12% of the Evaluation Points on a State Proposal

    This is often described as a set-aside. It is not: the programme page calls it goal-oriented and race and gender neutral, and what it actually delivers is evaluation points and a small-purchase route. No contract is reserved.

  • Military Family Assistance Fund — Up to $10,000 for Rent, Utilities and the Car

    The fund is widely described as help for deployed families. The department’s own page is broader: honorably discharged VETERANS are named alongside current Guard and reserve members, and the qualifying trigger is documented financial hardship, not a deployment.

  • A State Disability Payment for the Guard — $100,000, or $50,000 the Second Time

    Secondary write-ups routinely present this as a single state programme paying $250,000 on death and $100,000 on disability. The department’s own page does not. It calls the $100,000 and $50,000 sums a STATE disability benefit and describes the $250,000 death payment as a FEDERAL death benefit. The two are being conflated everywhere else, and the distinction decides which office a family should be talking to.

  • The VETERAN Designation — and a Licence Fee Discount You Have to Ask About

    This is recorded as a signpost, not as an entitlement, and should be read that way. The department says veterans "may qualify" for discounts or waivers and gives no amount, no threshold and no form. Anything that presents a Louisiana veteran driver’s licence as free is going beyond what the administering agencies publish.

  • Who the State Cemeteries Will Take — the Service Test, and a Guard Route the Federal Rules Do Not Have

    The widely repeated line is that any honorably discharged veteran can be buried in a state veterans cemetery here. The department publishes a real service floor and it excludes people: active duty for training does not count at all, and service beginning after 7 September 1980 (enlisted) or 16 October 1981 (officer) needs TWO CONSECUTIVE YEARS. A veteran with a short post-1980 enlistment and no Title 10 call-up, no retirement and no service connection does not meet the published test.

    Military honours are not arranged by the cemetery. The department’s own burial form states that no funerals are held at the cemetery, and that the funeral home is responsible for requesting military honours and for providing the burial flag. A family that assumes the cemetery organises the detail can arrive without one.

  • 25% Off the Liability Part of Your Auto Premium — and Since August 2026 You Apply Once, Not Every Year

    This is repeatedly written up as "25% off auto insurance for veterans". Two things are wrong with that. It is 25% of the LIABILITY portion of the premium, not of the whole policy. And for veterans and retirees it is not a mandate at all — both the insurance regulator and the veterans department describe it as voluntary, at the carrier’s discretion. The people the discount is actually written for are active-duty personnel and reservists based in this state and members of the state’s Army and Air National Guard.

  • Free Airport Parking at 50% — Unlimited at the Airport, Seven Days at the Cruise Terminal

    These are two different benefits with two different proofs, and they are usually run together as one. The airport limb needs a counsellor-certified form and an itinerary and is not limited by time. The cruise terminal limb needs a counsellor-certified form AND a military honors licence plate, and stops at seven days. A veteran who has the plate but no certified form, or the form but no plate, will be short of what the cruise terminal asks for.

  • The Veterans Honor Medal — Four Ribbons, and a Family Can Claim It

    The medal is commonly described as something presented at a ceremony to a selected few. It is not — it is applied for, by the veteran or by the family of a veteran killed in action, on an ordinary form, and the department will post an application to anyone who rings for one.

  • Fifteen Dollars Buys Three Modules, a Boot Camp and a Consultant Who Stays

    The programme is often listed as free. The agency’s own page puts a $15 registration fee at step one. It is small, but it is a payment and it is where the sequence starts.

  • Free Tolls on Both Toll Roads — But Only Through a Transponder Account Set Up First

    A Disabled Veteran plate on its own does not open the gantry. Both toll facilities are all-electronic; a vehicle without a qualified account is billed by post through toll-by-plate. The plate is proof of status in the application, not a pass at the road.

  • The Gold Star Plate Reaches Further Than Any Other — And It Is Not Free

    Remarriage does not end this one. The policy’s definition of immediate family says "a widow or widower, remarried or not" in terms — which is the opposite of the rule that governs most surviving-spouse benefits, and worth knowing before a remarried widow assumes the door is shut.

    This plate is not free. Regular registration and renewal fees apply and the handling charges sit on top. That distinguishes it from the disabled veteran plate, which the same set of policies describes as a free lifetime plate.

  • A Free Permanent Hang Tag With the Disabled Veteran Plate — Everyone Else Pays $3

    The plate and the hang tag are different things and a veteran needs both. The plate sits on one vehicle; the hang tag moves with the person into any car. Holding the plate alone means losing the space whenever you travel as a passenger in someone else’s vehicle.

Maine

A first pass over Maine statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Tuition AND Fees Waived for Dependents — 100% P&T, KIA or MIA

    Two details the summaries get wrong: the waiver covers mandatory FEES as well as tuition — broader than the tuition-only waivers most states run — and the completion clocks are asymmetric: ten consecutive years for a spouse, six academic years for a child. A child who defers past 22 without armed-forces cause is out.

  • Disabled Veteran Plates — No Registration Fee, Up to Three Vehicles

    Summaries stop at "free plates". The statute waives the annual registration fee itself, on up to three vehicles at once — and the excise tax, which towns collect on every registration and which usually dwarfs the registration fee, is exempt for total service-connected disability through its own provision.

  • Licensure for Veterans and Military Spouses — a Temporary Licence in 180 Days, Once Extendable

    Domestic partners are named alongside spouses in the statute. Summaries almost always say "military spouses" and stop there, which reads a whole category of applicant out of a right they have.

  • Examination and Licence Fees — Waivable for a Veteran, If You Ask

    The statute says "may ... after consultation". This is discretionary authority vested in one official, not an automatic waiver. A veteran told "there is no veteran fee waiver here" is being told the wrong thing, and a veteran told "your fees are waived" is being promised more than the section delivers.

  • Veterans’ Homes — Six Locations the Legislature Will Not Let Close

    There is no statutory rate to look up. §608, headed "Charges", was repealed in 2015. What replaced it is §604(7): the board adopts rules establishing just charges for the maintenance of members — and the statute expressly disapplies the Administrative Procedure Act’s rulemaking provisions to those rules. So the charges are set by a board without notice-and-comment.

  • Veterans' Emergency Financial Assistance — $2,000, Through Veterans Forward

    The pension route is routinely folded into the emergency route, as though every applicant has to show a crisis. §505(1-C)(A) does not: a resident veteran who has filed a valid pension claim and is waiting on the award may be granted up to $2,000 on that basis alone. Reading the two paragraphs as one test costs claims.

  • Memorial Cemetery System — Burial Without Charge, But Not the Headstone or the Vault

    "Free burial in the state veterans cemetery" is the usual summary and it is half right. Burial is without charge, but §504(3)(C) says plainly that headstones and vaults are not provided at state expense — and in a non-green section the vault is mandatory and must meet federal pressure specifications. Families budget for nothing and then meet a bill.

  • Maine National Guard Education Assistance — 100% of Tuition, One Credential Per Level

    Searches for this programme frequently land on 37-B M.R.S. §1071, which is REPEALED (PL 2001, c. 460, §2). The live programme is Title 37-B, chapter 3, subchapter 7-A, at §§351 to 360. An adviser working from §1071 will conclude Maine has no Guard tuition programme, which is wrong.

    The tuition grant section most write-ups cite, §353, is also repealed. The operative benefit section is §353-B, and it is drafted as a BENEFIT rather than a grant — which is why it reduces against other tuition assistance instead of stacking on top of it.

  • Property Tax Deferral — the State Pays the Bill and Waits, at 65 or on Disability

    Deferral is routinely lumped in with exemptions in state-benefit lists. It is the opposite instrument. An exemption removes tax permanently; a deferral postpones it and charges interest, with a lien on the home until it is repaid. A household that qualifies for both should not treat them as alternatives.

    The income and asset limits DOUBLED for applications filed after 1 January 2024 — from $40,000 income and $50,000 liquid assets for a sole owner to $80,000 and $100,000. Older guidance quoting the smaller figures excludes households that now qualify.

  • An Interview You Must Be Offered — and First Place in a Layoff

    Maine’s veteran preference is not a points system, and the section that used to be cited for one — 5 M.R.S. §7054 — is repealed. §7054-B, enacted by PL 2015, c. 438, replaced it with two concrete rights: an interview the agency must offer, and layoff retention. A candidate expecting a score bump on a Maine state examination will not find one.

  • One Free Vital Record for a VA Claim — Against a $15 Counter Price

    The waiver is frequently described as "free vital records for veterans". It is narrower on both sides: ONE copy, and only where the copy is used to determine eligibility for VA benefits. A veteran ordering a birth certificate for a passport pays the full $15.

  • The Town Must Keep the Grave — and Flag It Every Memorial Day

    This is routinely described as something towns do out of goodwill. It is a statutory duty drafted in mandatory terms, it reaches every public burying ground in the state rather than only the state cemetery system, and it carries a penalty. A family told that grave care is the family’s own business has been told wrong.

    The duty and the money are in different statutes and use different verbs. 13 M.R.S. §1101 says the municipality SHALL keep the grave in good condition; 30-A M.R.S. §5723(3) says it MAY appropriate money for the work. The permissive funding section does not cut down the mandatory maintenance section.

  • A Veterans' Benefit Cannot Be Attached — and the Home Is Protected to $160,000

    Veterans are frequently told that only the federal anti-attachment rule protects their VA money in a state collection case. Maine has its own, in its own words, and it is broader in one respect: it sits in the general exemption article and is claimed the same way as the household goods and the car, in the state court where the collection is happening.

    The residence figures in circulation are often the old ones. The section as read sets $80,000 and $160,000, and it adjusts automatically for the Northeast Consumer Price Index every three years from 1 April 2024, rounded up to the next $50. Check the current published adjustment rather than quoting a figure from a guide.

  • Deployment Is Not an Adverse Factor — the Custody Section for Guard and Reserve Parents

    The section is often summarised as protecting "deployed servicemembers". As enacted it names only members of the National Guard and the Reserves. A parent serving in an active component who deploys is not inside its words, and would have to argue the point on general best-interest grounds instead.

    It is not a bar on changing a child’s primary residence during a deployment. Subsection 2 forbids the change "unless the change is in the best interest of the child" — which is the ordinary standard. What the subsection really does is stop the absence itself from supplying the reason.

  • Maine’s Rental Chapters Carry No Military Termination Right — the Federal Act Is the Route

    Tenant-rights summaries frequently list a "military clause" among the lawful reasons to break a lease in this state, as though it were state law. It is not. The chapters that govern residential tenancies here say nothing about military service at all, and the right comes entirely from the federal Act.

  • Heating Help and an Electricity Credit — Income Only, at $38,070 for One Person

    There is no veteran preference, priority or set-aside in either programme. Both pages state eligibility in terms of household income and size and nothing else. A veteran reaches this help as a low-income household, which is worth saying plainly because energy help is one of the things veterans are most often told to ask their veterans’ office about.

  • The State’s Own Civil Relief Act — Testify by Video, Get an Expedited Hearing, Hand Contact Rights to a Relative

    The section is titled as a state Servicemembers’ Civil Relief Act, and it is routinely summarised as though it mirrored the federal statute. It does not. There is no interest-rate cap, no lease termination and no eviction protection in it. What it contains is four courtroom protections, and the most useful two — electronic testimony and an expedited hearing — are the ones nobody mentions.

    The stay is narrower than the rest of the section. Subsection 3 conditions it on the plaintiff, defendant or attorney being a member of the NATIONAL GUARD OR THE RESERVES, while subsections 5, 6 and 7 apply to any service member as subsection 2 defines the term. A regular-component member reading only the stay would conclude wrongly that the section does not reach them.

  • Fifteen Days of Family Military Leave — for the Spouse, Domestic Partner or Parent of Somebody Deployed

    This is widely listed as leave for "the family of a deployed servicemember". Two limits cut most families out. The relationship list is spouse, domestic partner or PARENT — an adult child of a deployed reservist is not on it. And the deployment must be to a combat theatre or an area where armed conflict is taking place, for longer than 180 days.

    The leave is not a state payment and is not administered by any agency. It is a duty on the employer, enforced by the employee in Superior Court. There is nowhere to apply and nobody to appeal to.

  • An Other-Than-Honorable Discharge Can Be Set Aside For State Benefits — Three Grounds, and a Clock in Days

    This is not a discharge upgrade. The federal characterisation is untouched — what changes is whether Maine treats you as a veteran for the rights, privileges and benefits granted under STATE law.

  • Fifteen Thousand a Year, In Statute, For the Vans to Togus

    This is the only state-funded route to VA medical care found in this state, and it is easy to overstate. It funds an organisation’s programme; it does not create an entitlement to a ride, and a veteran refused a seat has no claim under the section.

  • A Sentencing Docket For Veterans, Established by the Chief Justice

    The Judicial Branch’s own page does not state what completion earns, and the statute does not either. Whatever is on offer — a dismissal, a reduced sentence, a deferred disposition — is negotiated in the individual case, so ask counsel rather than assuming.

  • Gold Star Family Plates — Registration Fee Waived Since 2019, Excise Tax Still Due

    Guides written before 2019 describe this plate as costing the ordinary registration fee, and that is how §524-B itself once read. PL 2019, c. 390 did two things at once: it struck the registration-fee condition out of §524-B and added the exemption to §501. The excise tax condition survived both cuts, so the plate is not free of every charge — only of the registration fee.

  • The Parking Placard Turns on Walking, Not on a Rating — But It Costs Nothing, and Meters Are Free

    A service-connected rating is not a parking placard. §521 does not mention veterans, disability rating or the federal veterans department anywhere — the test is a clinician’s certificate about walking. A veteran rated 100% for a condition that does not impair walking is outside it, and a veteran rated 30% who cannot walk 200 feet is inside it.

  • The Veteran Flag on Your Licence — Free at Renewal, $5 If You Cannot Wait

    The statutory test is an honourable discharge, full stop. A general discharge under honorable conditions is used elsewhere in this state’s veteran law, but §1412(1)(B) says "honorably discharged" and names the DD214 as the proof — so a general discharge is worth asking about at the counter rather than assuming.

  • The Island Ferries Have No Veteran Fare — Read From the Tariff Itself

    This is a published absence, carried at zero weight. It is here because a veteran planning an island trip should not spend an afternoon looking for a discount that the fare authority does not contain.

Mississippi

A first pass over Mississippi statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • No Licence Needed at All — Under General Disability Law

    There is no annual certification letter to renew. This record previously warned that the agency letter had to be refreshed every year or an expired one would turn a lawful hunter into a citable one. Read on the wildlife agency's own hunting and fishing licence requirement pages, that is not what is required: an exempt resident must simply have proof of residency and of disability status in their possession while hunting or fishing. The agency goes further and states that exempt licences previously issued for disabilities are null and void, so a veteran chasing an annual renewal is chasing a document that no longer exists.

    The authority is the Code, not the administrative regulation this record used to cite. Both agency pages attribute the exemption to Miss. Code §49-7-5 and §49-7-9.

  • Top of the Eligible List — Disabled Veterans First

    This is not a points scheme. Nothing is added to a score — the preference changes where a name sits on the list the hiring agency sees, and the ordering between the two veteran tiers is fixed: disabled veterans before veterans.

  • State Veterans Nursing Homes — No Daily Charge at 70%, or on a Service-Connected Diagnosis

    Spouse admission here is narrower than the usual formula. The board does not admit a spouse on the veteran’s service alone: the eligibility route is being "a spouse of a veteran who is currently a resident" in one of the homes. If the veteran is not living there, the spouse has no route.

  • Professional Licence Reciprocity — Military Training Counted, Temporary Licence to Start Work

    This is not a fee waiver, and the board does not describe it as one. What it delivers is speed and credit for experience. A veteran expecting waived licence fees on this route will be charged.

  • State Veterans Memorial Cemeteries — Around $950 a Person, Not Free

    The single most costly assumption a family can make here is that a state veterans cemetery is free. It is not. Several states in this corpus bury a veteran without charge; this one charges roughly $950 a person under the Burial Equity Act, with a further $115 or $445 depending on the type of interment. Plan for it.

  • Every Document a Claim Needs, Free — Birth, Death, Marriage, Divorce and the Discharge

    Mississippi is usually listed as giving veterans free birth certificates. That undersells it badly. Marriage licences, divorce decrees, adoption decrees and "any and all other records" held by the chancery and circuit clerks are free on the same claim basis under §35-3-11 — which is often the harder document to get in a survivor claim.

  • The Disabled American Veteran Plate — Two Cars and a Motorcycle, a Dollar Each

    Mississippi is often listed as requiring 100% for a disabled veteran plate. The department’s own schedule sets two thresholds: 100% permanent and total, OR 70% and above where the rating is not permanent and total. A veteran at 70% who was told they did not qualify was told wrong.

    Do not read "veteran plates are free in Mississippi" from this record. The general Veteran and Veteran Motorcycle plates carry an EXTRA $30 annual tag fee on top of ordinary charges. The near-free plates are the disability plate at $1.00 and the specific award plates — Purple Heart, Silver Star, Medal of Honor, Ex-POW.

  • State Educational Assistance for the Guard — $5,000 a Semester, and You Must Be a Registered Voter

    The statutory summary and the operating programme say different things and both are true. Miss. Code Ann. §33-7-405 merely AUTHORISES the Adjutant General to pay tuition for "certain members"; the amounts, the GPA rule, the ten-year window and the voter registration condition are all programme rules published by the Military Department, not statutory entitlements. They can change without a change in the law.

  • Eight Semesters Without Cost — For the Child of a Prisoner of War or Missing in Action

    This is not the general "children of disabled or deceased veterans" scholarship several states run. Mississippi’s §37-108-1 route is narrow: it turns on a POW or MIA report, not on a disability rating or a service-connected death.

  • A Cemetery Place for the Guard, the Reserves and ROTC — Who Pays, and Who Is Inside

    A Guard or Reserve member who never served a qualifying period of active duty is usually told, correctly, that a national cemetery will not take them. That answer is now wrong for the state cemeteries here. Since 1 July 2024 subsection (6) opens them to reserve component and National Guard members, to ROTC members who die in the programme, and to their spouses and children.

    This is not a free burial and the statute does not pretend otherwise: all costs associated with the interment are on the applicant unless federal or state aid is specifically provided. Read it alongside the state cemeteries record for what the charges are.

  • Deployment Is Not a Change of Circumstances — and the Hearing Goes to the Front of the List

    This is far more than the "deployment is not a factor" rule it is usually reduced to. Three of its provisions are worth as much or more in practice: the ten-day sunset on any temporary custody order, the power to delegate visitation to a grandparent or other close family member during the absence, and the statutory precedence that moves the hearing ahead of the ordinary docket.

    The definition of "mobilization" expressly excludes National Guard and Reserve annual training. A Guard parent whose absence is annual training is outside the section and should not rely on it.

  • What a Creditor Cannot Take — Including a Shield Built for Military Retirement Pay

    The section contains NO veterans’ benefit exemption. It was read end to end and the words do not appear. VA compensation and pension are protected by federal law rather than by this section, and a veteran told that state law shields them here has been told something the statute does not say.

    The homestead is not in this section either. §85-3-1 covers a mobile home used as a primary residence at $30,000, and it says in terms that a debtor claiming the homestead exemption under §85-3-21 cannot also claim the mobile home as personal property. The two are alternatives, not a stack.

  • Heating and Cooling Help at 60% of State Median Income — and the Queue That Decides Your Date

    There is no veteran priority in this programme and the department’s own page does not mention veterans at all. The priority classes are elderly, disabled, and households with a child aged five or younger. A veteran who is told to ask a veterans’ office about heating help will be sent back to the county human services office in the end.

  • A Veterans Treatment Court a Circuit Judge May Build — With the Prosecutor Holding the Key

    There is no municipal veterans treatment court. A 2024 bill would have let a municipal court judge establish one wherever a municipal drug court already existed; the section as brought forward in 2025 still authorises the circuit court level only. A veteran charged in municipal court is not in this chapter.

  • The Three Percent Disabled-Veteran Contracting Goal Is a Bill That Died, Not a Law

    This is a bill-text-mistaken-for-law problem, and it is a common one. Legislative sites publish introduced bills in the same shape as enacted text, so a search engine returns the words of a dead bill looking exactly like a statute. The history page is the check: read the disposition line before quoting any of it.

Montana

A first pass over Montana statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Working Military Retiree Exemption — Narrow, and Easily Lost

    Summaries file Montana under "partial exemption" as though half of military retirement were simply exempt. The real shape is narrower: working retirees only, capped by Montana earned income, five consecutive years, programme sunset in 2033 — and permanently forfeited by leaving the state.

  • Last-Dollar Tuition Waiver — For the Veteran Whose GI Bill Ran Out

    Summaries describe a wartime-veteran fee waiver. The operating programme is narrower on three counts the pages state in terms: the discharge must be fully Honorable, the veteran must have elected federal education benefits and used them up (or aged them out), and the waiver is last-dollar against in-state tuition only — a Pell-covered student can net zero from it.

  • Licensure Reciprocity for Members, Spouses and Veterans — Including a Temporary Credential

    This is often listed as a military licensing fee benefit. It is not: there is no fee provision in the section and no fee waiver anywhere in it. What it delivers is a route and a temporary credential.

  • Veterans’ Homes — Three of Them, and Residency Is a Factor, Not a Bar

    Most state veterans homes gate admission on a residency period. This one does not. The Code names "the person’s term of residence" as one factor the department must consider alongside age, health and housing alternatives — so a recently arrived veteran is weighed, not refused.

  • Public Employment Preference — 5 Points, or 10 With a Disability

    The interview guarantee is the part most often misreported. §39-29-102 permits an employer to guarantee an interview to a qualifying veteran who requests the preference, but that guarantee sits apart from the enforceable preference claim — it is not something an applicant can insist on in the way the points and the substantially-equal rule can be insisted on.

  • County Interment Allowance — Up to $500, Plus $100 to Ship the Headstone

    This is a county obligation, not a state one, and it is not means-tested on its face — §10-2-501 attaches to the veteran’s residence, not to indigency. Families are often told the county only pays where there is no money, which is not what the section says.

  • Tuition AND Fees Waived by Statute — War-Era Veterans

    Montana’s veteran tuition waiver is usually described only through the Board of Regents policy for veterans whose federal education benefits have run out. That policy is real but it is not the statute. §20-25-421(2)(c) is a separate and in places wider entitlement — it covers fees as well as tuition, it does not require exhausted GI Bill benefits, and it names four categories of family member the policy route does not.

  • Back From a Contingency Operation: a Free Conservation Licence and Five Years to Use It

    Montana is often listed as giving disabled veterans free hunting and fishing licences. It does not. The combat-connected injury route in §87-2-817(1) is a HALF-FEE route on named deer and antelope tags, and the department caps it at about fifty licences a year. The genuinely complimentary package is the contingency-operation one, and that turns on deployment rather than on disability.

    The word "complimentary" in subsection (2) covers the conservation licence and the fishing or combination sports licence only. The resident base hunting licence fee is still payable and the aquatic invasive species prevention pass must still be bought — the section says so expressly.

  • The County Clerk Records Your Discharge Free — and It Stays Confidential for Sixty-Two Years

    This is often summarised as "Montana counties will store your DD214". The recording is free; the section says nothing about free copies, and it is the confidentiality regime rather than the storage that carries the real protection.

  • A Mortgage One Point Below Market, Paid For by the Coal Trust — and No Income Limit

    This is a loan, not a benefit payment, and lists that put it beside grants and exemptions mislead. Nothing is forgiven: the principal returns to the Montana housing trust, and the interest the board collects pays origination, servicing and administration before any surplus goes back to the trust.

    The rate rule is a "whichever is less" test and is easy to read backwards. It is not simply one point off the market rate — it is the LOWER of one point below the Fannie Mae delivery rate and one point below the board’s own cheapest other programme.

  • Deployment Cannot Be Held Against You in a Parenting Case — Four Sections That Say So

    These protections are routinely described as "Montana has adopted the Uniform Deployed Parents Custody and Visitation Act". It has not. The protection is four separate subsections bolted into the ordinary parenting statutes — §40-4-212(2), §40-4-219(10), §40-4-228(6) and §40-4-234(3) — which is why searching for a single deployed-parents chapter finds nothing and the benefit looks absent.

    There is no expedited-hearing provision here. Guides that promise a deployed parent a fast-tracked hearing are importing that from other states’ versions of the uniform act; the Montana sections read this session contain no such right.

  • Four State Veterans’ Cemeteries — Nothing for the Veteran, $800 to Open a Spouse’s Grave

    A state veterans’ cemetery is widely described as free for the veteran AND the spouse. In Montana it is not. The division’s own fee schedule charges a spouse or dependant an $800 opening and closing fee that a veteran is not charged, which turns a $100 cremation into a $900 one. A family planning on the strength of "no cost to the family" should read the schedule before the funeral director does.

    The count is four operating, not three and not five. The Code names Fort William Henry Harrison, Missoula and Miles City and authorises Yellowstone County and Columbia Falls subject to funding; the division’s own cemetery pages show Columbia Falls open as the Northern Montana State Veterans Cemetery. Yellowstone County is still the one that has not materialised.

    The eligibility terms are not in the Code, and reading them out of the statute would be inventing them. §10-2-601 establishes the cemeteries and §10-2-602 hands the criteria to the board’s rules; the three-part test recorded here comes from the division’s own pages, not from the section.

  • Ordered 60 Miles Away: End the Lease, the Phone, the Internet and the Cable — No Termination Fee

    Montana’s military lease-termination right is not in the Residential Landlord and Tenant Act. Title 70, chapter 24, part 4 was read in full this session — sections 70-24-401 to 70-24-442 — and §70-24-441, "Termination by landlord or tenant", is nothing but notice periods of seven days for a week-to-week and thirty days for a month-to-month tenancy, with no armed-forces provision anywhere. Part 2, the rental agreements part, is five sections and mentions the military nowhere. A tenant who reads the tenancy act and concludes Montana gives them nothing has read the wrong title.

    The telecom half is regularly reported as a right to cancel "if you deploy". It is not. The trigger is a reassignment to a new permanent duty station, and the further test is that the SERVICE is unavailable at comparable quality and cost there. A provider that serves the new station at the same price is entitled to keep the contract on foot.

  • The Court Can Stop the Eviction Clock for Three Months — and Rewrite the Payment While You Serve

    The Montana National Guard Civil Relief part contains no interest rate cap. The federal Servicemembers Civil Relief Act’s six percent rule is the one everybody quotes, and it is federal — §10-1-903 was read in full this session and caps nothing. A Guard member who asks a Montana lender to cut the rate to six percent under state law is citing a provision that does not exist.

    A stay is not forgiveness. The same subsection that grants the delay lets the court order the amount paid over a period after release from active duty. The debt survives the deployment; only its timing moves.

  • 120 Hours of Paid Military Leave for Public Employees, and a Job to Come Back To

    Guard and reserve members are usually told their reemployment rights are federal and that the state adds nothing. Montana has its own act — Title 10, chapter 1, part 10, the Montana Military Service Employment Rights act — with its own complaint procedure, its own department investigation, referral to the attorney general, an expedited hearing and court remedies. It is not a restatement of the federal scheme, and §10-1-1004 addresses the relationship between the two.

    The 120 hours are not accrued month by month and are not "up to" anything. §10-1-1009(1)(b) credits the entitlement IN FULL once six months of employment are complete, and again in each successive year. An employer prorating a new employee’s first year is reading the section wrongly.

  • A Private Employer May Lawfully Prefer a Veteran — and Many Do Not Know It

    This is not a hiring preference a veteran can insist on. It authorises an employer to have one. A veteran who reads it as an entitlement in the private sector will be disappointed, and an employer who reads it as a mandate is also wrong.

  • Veterans Treatment Courts Exist Here — But No Section of the Code Names Them

    There is no veterans treatment court act here. Title 46, chapter 1 has a part for drug treatment courts and a part for mental health treatment courts and nothing else; the twelve definitions at §46-1-1103 were read one by one and none mentions service. Anyone citing a statute by name for these dockets is citing something that does not exist.

  • Gold Star Family and Next-of-Kin Plates — and the Plates a Widow May Keep

    Gold Star plates are widely described as free. Subsection (3) opens by requiring payment of all applicable registration fees AND the special license plate fees before either plate may be issued. The recognition is free of charge only in the sense that no extra recognition fee is invented — the ordinary money is still due.

  • The "DV" Plate Is a Parking Permit — No Doctor’s Certificate Needed

    A rating alone is not enough. Section 61-3-458(4)(b) sets two specific doors — Purple Heart with 50% or more, or 100% rated or paid at the 100% rate. A veteran at 60% without a Purple Heart does not reach the DV plate, and should use the medically certified permit route in 49-4-301 instead.

  • War Orphans Waiver — Tuition Only, Age 25 and Under, Combat-Related Death

    The statute says "tuition and fees". The policy that runs the waiver says the opposite in section I.C: only tuition is waived, and no fees of any kind are. A family reading only the code will budget for the wrong number.

    The statute reaches the spouses or children of residents declared prisoners of war or missing in action. That category has no matching item in the Board of Regents designated waiver list read this session. Anyone in it should press the Commissioner’s office on the statutory authority rather than accepting a campus-level no.

  • Heating Help Has No Veteran Door — and Your VA Money Counts Against You

    Directories of veteran benefits often list heating assistance under a state’s veteran programmes. It is not one here. The programme manual — the document caseworkers actually apply — never mentions veterans, and treating it as a veteran benefit sets up a refusal that feels personal but is simply arithmetic.

Nebraska

A first pass over Nebraska statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Homestead Exempt — No Income Test, and No Value Ceiling Either

    This record used to state a value ceiling of the larger of 120% of the county average home value or $50,000 above it, and said a home above the cap received a reduced exemption. There is no value ceiling on Category 4V. The record's own title was built on the cap.

  • Military Retirement — 100% Excluded, No Election

    Before 2022 Nebraska ran a partial exclusion that had to be ELECTED on time, and veterans who missed the election lost it. The election is gone — the 100% exclusion is automatic, and prior electors need not do anything.

  • Waiver of Tuition — 100% of Tuition and Fees for Dependents

    Summaries describe this as free college for dependents. The degree ceiling is the trap: one community-college credential plus one bachelor's, and nothing at graduate level — a dependent planning a master's on this waiver has misread it.

  • Veterans’ Homes — $0 to $5,549 a Month, and Nothing at All at 70%

    The residency requirement is unusually forgiving and is routinely reported as an ordinary two-year rule. The department states two years lived here at any point in your lifetime — so a veteran who grew up here, left for a career and came back at 80 meets it on childhood alone.

  • Veterans’ Aid Fund — Temporary Emergency Money, on a Closed List

    The fund is often described as a general hardship grant. It is not general: the department names eight categories and nothing outside them can be paid. A veteran behind on a credit card or a court fine is outside the fund however severe the emergency.

  • State Veterans Cemeteries — No Fee for Any Service, Spouses Included

    Most state veterans cemeteries in this corpus charge a family something — a plot allowance for a spouse, an interment fee, or the vault. This one states there are no fees for any services it provides. A family told to expect a bill for a spouse’s interment should check that against the cemetery’s own page before paying.

  • Vets Get Pets — Up to $350 of Adoption Fees, Once

    It reads like a token gesture and it is not quite: $350 covers most shelter adoption fees outright, including the ones that bundle vaccination and neutering. But it is genuinely once per veteran, and the preauthorization step is mandatory — a veteran who pays the shelter first has no route to reimbursement described here.

  • Reservist Tuition Credit — 75% Off, With Only 200 New Places a Year

    Nebraska’s education benefit is almost always described as the Waiver of Tuition for dependants. That leaves serving reservists believing the state offers them nothing. It offers them this — but with a hard cap of 200 new places a year, which is the detail that decides whether an application succeeds.

  • Lifetime Hunt, Fish and Park Permits at No Fee — From 50%

    These are frequently described as "free hunting and fishing licences for disabled veterans". The permit is a SMALL GAME hunt/fish/fur harvest permit. Big game — deer, elk, antelope — is not inside it, and a veteran planning a deer season on the strength of this permit will be buying tags anyway.

  • Military Honor Plates — $5 Numeric, $40 Message, and No Limit on How Many Vehicles

    The Military Honor plate is not free and is not a registration discount. It replaces the regular county plate for a fee of its own. Nebraska’s actual vehicle money benefit is the separate motor vehicle tax and fee exemption for disabled and blind veterans, which is a different programme with a different application.

  • A VA Pension Is a Door Into the Phone Discount — $3.50 From the State on Top of the Federal $9.25

    This is the state benefit Nebraska’s veterans department does not list. Its April 2026 Guide to Veterans’ Benefits was read in full this session — thirty pages, every state programme named one by one — and NTAP appears nowhere in it. A veteran drawing a VA pension who relies on that guide will never learn the phone discount exists, and it is the Public Service Commission rather than the veterans department that runs it.

    It is the PENSION that qualifies you, not a disability rating. Veterans Pension and the Survivors Benefit are needs-based awards; a service-connected compensation rating, however high, is not on the commission’s list. A 100% service-connected veteran with no pension comes in on income or not at all.

  • Two Counties Have a Veterans Treatment Court — Graduate and the Charges Are Dismissed

    Nebraska does not have a statewide veterans treatment court. The veterans department’s own legal page names exactly two — Douglas and Lancaster — out of ninety-three counties. A veteran charged in any other county is in the ordinary criminal system, and the usual summaries that say "Nebraska has veterans treatment courts" hide that.

    The free legal clinic is not currently open. The University of Nebraska’s Veterans Coffee and Counsel page states the clinic is at capacity and is not presently accepting cases, and says it will add an application form when that changes. It is listed here because the department still points veterans at it.

  • The Attorney General Runs a Military Consumer Desk — and an Active Duty Credit Alert Is Free

    The protections the Attorney General lists under this heading are federal, not Nebraskan. The Servicemembers Civil Relief Act, the Military Lending Act and the Fair Debt Collection Practices Act are all acts of Congress, and the office says so. Nothing on the page is a Nebraska statute conferring a right, so a servicemember should not expect a state-law answer to a lease or interest-rate problem from this route — the state contribution is enforcement and advice.

    An active duty alert is not the same as a credit freeze and is not the same as the fraud alert a civilian places. It is specific to deployment, runs for one year rather than ninety days, and is renewable for the length of the deployment.

  • The Veteran Designation on Your Licence — Free at Renewal, Chargeable Any Other Time

    The designation is described everywhere as free. It is free only if you ask for it at renewal. The DMV’s own page says that asking in between makes it a replacement document with the replacement fee attached — which is a real cost for a veteran who has just registered and does not renew for four more years.

  • Tick the Box and Somebody Rings You Back Even When You Did Not Get the Interview

    The name promises more than the programme delivers. What is described is a call back and resume help for an applicant who was NOT selected to interview — not an interview for every veteran who applies.

  • The Ride to the VA Hospital Is a Volunteer Van, Not a State Programme

    The van fleet is run by a veterans service organisation and staffed by volunteers, not by the state and not by the federal VA. That matters when it is cancelled: there is no agency with a duty to provide a replacement.

  • Gold Star Family Plates — and Remarriage Does Not End Them

    A remarried surviving spouse is eligible here. That is worth saying twice, because remarriage ends survivor eligibility in so many programmes that people stop asking. The department’s eligibility list settles it in five words.

    The "$40 Gold Star plate fee" that circulates is only half the story. It attaches to the personalised message plate. The plain numeric plate carries no fee at all, and the ordinary registration fees are payable either way.

  • The Disabled Veteran Plate Does Not Let You Park in an Accessible Space

    The single most costly assumption in this record: a Disabled Veteran plate is not a handicapped plate. The department states plainly that it does not allow parking in a designated handicapped space. The plate recognises service-connected disability; accessible parking is decided by a clinician, on a different form.

  • A Respite Network the Legislature Built — Six Regions, One Phone Number

    The network is not a veterans programme and does not hold itself out as one. It is worth knowing about precisely because it is not — a caregiver turned away from a veteran-specific route still has this door, and the coordinator can often braid the two together.

New Hampshire

A first pass over New Hampshire statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Town-Voted Credits, Up to $5,000

    The optional total-disability credit ceiling was published here as $4,000. RSA 72:35 as amended effective 2025 sets the standard credit at $700 and the town-adopted range at $701 to $5,000.

  • No Tax on Any Personal Income — I&D Tax Repealed

    Guides written before 2025 warn that the state taxes interest and dividends at 3–5%, which mattered to retirees living on savings. That tax no longer exists for periods beginning after 31 December 2024 — the warning is stale.

  • Half-Price Lifetime at 80–99% — After Two Years at That Rating

    Summaries that mention this state's licence benefit collapse both routes into "free licences for disabled veterans." Neither half is right: the 100% licence costs $10 once and is perpetual, and the 80-99% licence is half of the ordinary lifetime price with a two-year tenure rule — waivable only by asking the department.

  • State Park Day Use Free — At ANY Service-Connected Rating

    Benefit lists often file this under "100% disabled veteran" benefits. The provision reaches ANY service-connected rating — a 10% veteran walks in free with a VA letter, no plate required.

  • State Veterans Cemetery at Boscawen — Residency Not Required

    Most state veterans cemeteries require state residency or entry into service from the state. This one states plainly that residency is not required — an out-of-state veteran's family weighing options should know Boscawen is open to them. Residency does, however, change the PRICE on the Selected Reserve routes: no fee for a resident veteran, $1,050 for a non-resident one.

    The state veterans department's benefits page says to ring the cemetery for eligibility and fees. The cemetery publishes a fee schedule, and it is specific: no fee for an eligible veteran, $450 for an eligible dependent, $1,050 on the non-resident Selected Reserve routes, plus a separate schedule for disinterment. A family does not have to go into that call without a figure.

  • The State Veterans Home — $348 a Day, or 90% of Income Above $100

    A non-veteran spouse cannot be admitted. The Home's FAQ answers "Can my spouse be admitted?" with: only if that spouse is themselves a veteran who meets the criteria. Couples planning around a state home should know this before they apply, because it is the opposite of what most state home programmes do.

  • Your Town Must Support You — RSA 165:5, and the Burial That Goes With It

    Veterans here are routinely told the state has no emergency assistance programme. That is true and misleading in the same breath. What exists instead is stronger in principle — a statutory duty on the municipality rather than a discretionary fund that can run dry — and weaker in practice, because it depends on a town office knowing the provision applies.

  • Three $100 War Bonuses — and the One That Another State Can Cancel

    The bar on having been paid a Persian Gulf bonus elsewhere is the detail nobody mentions. Veterans who moved between states during the 1990s are precisely the people who may have been paid once already, and are precisely the people most likely to claim again in good faith.

  • Guard Tuition — Free, Space Available, and Transferable to a Spouse

    Residency here is not required for the member — the department states an active member "residing either in-state or out-of-state". A member who drills here but lives across a border should not rule themselves out.

  • Four Motor Vehicle Fee Exemptions, and Free Parking With the Plate

    These are condition-based, not rating-based. A veteran at 70% with a mobility impairment is outside them; a veteran classified permanently and totally disabled is inside. Reading them as a percentage benefit is the commonest error.

  • State Employees — 15 Days Paid Military Leave, Then 30 More at Partial Pay

    This is an employment benefit for people still serving, not a veterans benefit. It is recorded here because the corpus had nothing at all for the state employee who is also a reserve component member, and that is a large and quiet population.

  • Your Town Job Back — But You Have Ninety Days to Ask

    The federal reemployment law that most people have heard of has its own, longer and more graduated set of application deadlines. This is a separate state provision with a single flat ninety-day window, and a veteran who assumes the federal timetable applies to a town job here can be badly out.

  • First in the Queue for Publicly Funded Training

    The two provisions are different things. RSA 115-B is a state statute about publicly funded training generally; priority of service is a rule applied inside federally funded workforce programmes at state employment offices. Claim both, separately.

  • The Compact That Stops a Move Costing Your Child a Year

    The compact is not a discretionary courtesy from a friendly school. It provides for administrative rules and for their enforcement, which is why escalating past the school office is a legitimate step rather than an aggressive one.

  • Six Veterans Tracks — and You Must Live AND Have Offended in the Same County

    Coverage of the 2024 legislation described a veterans treatment option in every county. The department’s current page still says six veterans tracks, and still carries the county residence-and-offence rule. Ask the court which track it has before assuming statewide coverage.

  • Gold Star Family — a $10 Decal for Everyone, and a Free Plate for Mothers

    This record used to say outright that no Gold Star plate exists in New Hampshire and told readers to stop looking for one. RSA 261:87-c provides gold star number plates to mothers and stepmothers of service members killed on duty, free of number plate fees. The decal and the plate are two different things and both are real.

  • Electricity, Fuel and Weatherisation Help — No Veteran Door, but a Wide Discount

    Veteran-specific utility discounts are widely assumed to exist and largely do not. That holds here: the department’s eligibility page runs entirely on household income, and neither of the pages read this session mentions veterans at all. What exists is a general programme a veteran household may well qualify for on income alone.

  • Caregiver Respite Exists — a State Veteran-Directed Programme Does Not

    The aging network’s veterans page is the finding here, and it establishes something by what it does not contain. Every entry on it is federal, charitable or a residential facility. There is no state-funded caregiver stipend or veteran-directed care programme to apply for, and a family spending weeks searching for one is chasing something that is not there.

North Dakota

A first pass over North Dakota statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Your Percentage of $9,000, Off the Taxable Value

    The ceiling rose from $8,100 to $9,000 — tables all over the internet still carry the old figure at every band.

  • Hunting at $10, Fishing at $10 — From 50%

    Secondary summaries circulate a "$3 combined licence at 100%" figure. The department’s current table shows $10 at 50%+ for the combined hunting licence and $10 for fishing, with no separate 100% tier — the $3 figure does not appear.

  • Dependent Tuition Waiver — Tuition AND Fees, No Month Cap Stated

    University-system pages state a 45-month benefit limit. The administering department's page names no month cap and says eligibility continues for so long as the dependent is eligible. We publish the department's version and flag the discrepancy rather than silently adopting either.

  • Provisional Occupational Licence for Military Spouses — Three Years, No Application Fee

    The six-month window for a veteran's spouse is a real deadline and it is not obvious: it runs from the veteran's discharge, not from the move or from the job offer. A family that separates from service, spends a few months settling, then looks for work has already lost it.

  • Hardship Grants — $5,000 a Year, Paid Straight to the Vendor

    The two ceilings are easy to confuse. The general hardship grant is capped per calendar year. The emergency-repair grant carries BOTH a yearly limit and a $7,000 lifetime limit — meaning a veteran who draws it heavily once may have little left for a second emergency years later.

  • Veterans Preference — Absolute, Not Points

    The word to hold on to is "absolute". A points preference improves your position among candidates; an absolute preference is a priority over them. Veterans who have moved here from a points state routinely under-claim because they are looking for a number that does not exist.

  • Motor Vehicle Excise Tax — Exempt on Two Vehicles at 100%

    Excise tax and registration fees are two different charges, and veterans routinely think the plate exemption already covered both. It did not. The excise tax is levied on the purchase price at titling and is by far the larger number on a newer vehicle.

  • The State Cemetery — Free for the Spouse Too, Since 2020

    Guidance written before 2020 — and a good deal of it is still circulating — says a spouse or dependent interment here costs money. It does not. That change is recent enough that funeral directors and families both still repeat the old position.

  • Deployment and Custody — Temporary by Law, With an Expedited Hearing and Testimony by Video

    The uniform act on which this chapter is based contains a section barring a court from treating a parent's past or possible future deployment, by itself, as a reason to change custody. That section is NOT in the chapter as enacted here — section 103 in this state is remedies for noncompliance. A parent who has read about that protection elsewhere should not assume it is in this state's statute book, and should ask a lawyer what does protect them.

  • A Free Ride to a VA-Authorised Appointment — 36 of 53 Counties

    Two different rural transport schemes have run here and they are constantly confused. The pandemic-relief state grant was published as available from 1 December 2021 through 31 December 2024 or until funds ran out. The scheme still described on the department’s transportation page is the federal highly rural grant it has held since October 2015. Ask which one before you plan a journey around it.

  • Women Veterans — A Registry Card and a Survey, and the Rest Is Still Being Built

    Directories list a women and minority veterans state coordinator for this state at an address in Fargo that is a federal regional office. The department’s own women veterans page describes no state coordinator post. If you are told the state has one, ask which agency employs them before you rely on it.

  • Two Plates for a Family That Lost Someone — and the Second One Is the Forgotten One

    The plate is free; the registration is not. The department is explicit that no additional fee is charged for the distinctive plate itself while all other vehicle registration fees apply. A family expecting a free registration will be surprised at the counter.

  • Veteran Indicator on Your Licence — Free at Renewal, $8 Any Other Time

    The indicator is often described as free. It is free only at renewal. Walk in mid-cycle and you are buying a duplicate licence for $8 — small money, but it is the difference between a free errand and a paid one, and waiting for your renewal date costs nothing.

  • The DAV Plate Parks Without a Placard — and the Placard Itself Is Free

    Veterans routinely queue for a medical placard they already have the benefit of. The transport department’s own parking page says the DAV plate carries the parking privilege without a permit. The placard is worth having as a second route, not as a prerequisite.

  • Caregiver Respite — and the Clause That Shuts a Veteran’s Family Out

    This is the opposite of the usual pattern. Most state programmes treat a veteran connection as an extra door in. Here the handbook makes access to federal veterans-department respite a disqualifier: if the care recipient is able to receive it there, the caregiver is not eligible for this programme at all.

Rhode Island

A first pass over Rhode Island statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

  • Burial at Public Expense — With a Statutory Cap of $55

    A $55 cap on a funeral is not a benefit anyone should plan around, and we would rather say so than let the existence of a statute imply real help. The arrangement duty is the usable part; the money is not.

  • State Floors, Town Money — and Wartime Service Is Enough for the Base Tier

    This record used to require a 100% permanent and total rating. RIGL 44-3-4 requires no disability at all for its base tier — wartime service and an other-than-dishonorable discharge are the whole test. The disability amounts sit on top of that tier rather than gating it.

  • Permanent Combination Licence, No Fee — Permanent Disability, Any Cause

    This record previously reported that annual reconfirmation might be required. RIGL §20-2-31(c) says the opposite in terms: papers are presented once and the holder shall not again be required to appear.

  • Disabled Veteran Plate — Free Plates AND Free Registration

    Summaries describe this as a free plate. The DMV page says more: "There is no charge for the plates or registration for this plate type" — the recurring registration fee disappears too, which over years is worth far more than the plate.

  • Civil Service Points — 5 for Veterans, 10 Needs a Campaign Medal

    The 10-point tier is routinely summarized as "10 points for disabled veterans." The state's definition demands a campaign ribbon or expeditionary medal on top of the disability — a peacetime-service veteran with a service-connected rating gets 5 points here, not 10.

  • Free Public College Tuition From a 10% Rating

    Free-tuition benefits are almost universally summarized as "for 100% disabled veterans." This one opens at 10% — the lowest education gate verified in any state — and the binding condition is procedural instead: financial aid must be applied for and used first.

  • Burial at the Veterans Memorial Cemetery — Free, Five Ways In

    The March 2022 expansion is missing from most summaries: six years in the Guard or a Reserve component now qualifies — including service in ANOTHER state's Guard, if the person lived here two consecutive years before death. Families told a non-deployed Guard member cannot be buried at Exeter are working from the old rules.

  • The State Veterans Home — Wartime Service, and 80% of Adjusted Net Income

    Wartime service is a real gate here, not a preference. The home's own page puts it plainly: 90 days of active service during wartime. General guides that describe state veterans homes as open to any honorably discharged veteran do not describe this one.

  • The Military Relief Fund — Up to $5,000, But Only While You Are Still Serving

    The most important fact about this fund is what it is not. It is listed among veterans benefits and it is emphatically not a veterans benefit: eligibility runs on current good standing with a unit. A veteran who separated years ago and needs help with rent will be refused, and should go to the federal supportive-services programme or a service organisation instead.

    The requirement that the crisis be caused by a deployment or mobilisation was removed in 2013, and the fund was later widened to include active-duty components. Older summaries still describe a deployment-linked fund, which turns people away who now qualify.

  • First Placement in Elderly Public Housing for a Wartime-Disabled Veteran

    A preference is not an allocation. It orders you within a waiting list when a unit becomes free; it does not create a unit. A veteran told they have "priority" and then left waiting has not been misled — that is what the provision does.

  • Guard Tuition Assistance — Five Free Classes a Semester

    This is not the same programme as the summer exemption, which is separate, differently limited, and needs a certificate obtained before registration. A member who claims one and assumes it covers the year misses the other.

  • The Summer Exemption — the One That Needs a Certificate First

    Two programmes, similar names, different rules. The assistance programme covers autumn and spring at up to five classes; this exemption covers summer at one course a semester. A member who reads only one page gets a third of the entitlement.

  • No Foreclosure Without a Court Order — and It Lasts Nine Months After You Come Home

    The office's page carries a federal sentence that expired: it describes the federal protection as lasting one year after discharge "until December 31, 2014". Do not plan around that sentence. The state figure the same page gives — nine months after discharge from active duty — is the one to work from, and the current federal period should be checked separately.

  • In-State Tuition From Day One — No Residency Waiting Period

    The page is headed as a veteran benefit but most of what it describes is written around ACTIVE DUTY service and around federal benefit eligibility. A separated veteran with no transferred benefit and no Fry Scholarship should ask the institution directly which route, if any, they are on.

  • Veterans Treatment Court — One Calendar for the Whole State, at Warwick

    People assume a veterans treatment court means a court in their county. Here it means one designated calendar at the Kent County District Court in Warwick. If you are being told your local court has one, ask which judicial complex it sits in.

  • The Bus Pass Is Not a Veteran Pass — It Is the Disability Pass, and It Costs $10

    The widely repeated claim is that a veteran rated 100% service-connected rides free statewide. The transit authority’s own veterans page describes no veteran-specific pass at all, and the state veterans office’s page on the same programme repeats the authority’s language rather than a veteran entitlement. A veteran may well get a free pass here — but through the disability programme, on its terms, for $10.

  • Veteran Disability Parking Placard — a VA Letter Instead of a Doctor

    The disabled veteran plate and this placard are different things applied for in different places. The plate needs an executive certification obtainable only from the state veterans department office in Providence; the placard needs a VA regional office letter sent to a placard desk in Cranston.

  • Gold Star Family Plate — One Set Per Family Member, on a Lapel Button Test

    Describing this as a Gold Star parent plate understates it. The division’s own page reads the eligibility as anybody who may receive the federal Gold Star Lapel Button, and allows one set per family member — so a surviving spouse, a sibling and a parent can hold plates at the same time.

South Dakota

A first pass over South Dakota statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Vermont

A first pass over Vermont statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

Wyoming

A first pass over Wyoming statewide law. We publish the two things that decide the most money — property tax and income tax — and say plainly what we have not yet researched rather than padding the list.

What is not published yet

These 598 are benefits we have reason to believe exist and have not verified. They are listed so you can see the shape of the gap. None of them appears in a match, carries a value, or has a page — an unverified record is not a record.

Florida — 4 on the worklist

Five research passes over Florida law. The fifth acted on an independent audit of this page and corrected two things we had wrong: §196.081 asks for a VA certification of TOTAL and permanent disability rather than the word "permanent" alone, and §316.1964 exempts every disabled veteran plate from parking fees rather than only the wheelchair-symbol one — we had been understating that plate. It also added the parking-fee exemption itself, the $75,000 active-duty death benefit and the 120-credit survivor waiver under §295.061. The audit lists further additions we have not yet made. What is still thin is the local layer beyond the ten counties and operators we hold: Florida has 67 counties and over 400 municipalities.

  • Broward County Transit Veteran Fare

    low confidence it exists · County transit fare policy

    The spec named Broward alongside JTA as a no-geography transit benefit for veterans. JTA verified and is published. Broward did not: the county's own reduced-fare ID card page lists youth, seniors, disability and Medicare categories and does not mention veterans at all. Secondary sources describe a 50% reduction limited to PARATRANSIT trips to a VA clinic, which is a materially different benefit from a fixed-route pass.

    Still needed: The paratransit fare policy itself. Broward migrated its site and the document paths cited by search engines now 404, so this could not be read on the verification date. If the VA-clinic reading is right, this belongs in the corpus as a narrow paratransit record and the "Broward transit pass for veterans" framing should be corrected on the record.

  • Florida Keys Aqueduct Authority Disabled Veteran Discount

    medium confidence it exists · Authority board policy

    FKAA's own "Apply For" page confirms a lower residential rate reaching "a permanently disabled American Veteran", and our calendar already carries its 31 March re-certification date. The third pass narrowed it but could not close it.

    Still needed: Three things the published page does not state: the discount percentage, which charge it applies to, and — the one that decides who can claim it — whether the maximum income allowance gates the veteran branch or only the age-60 branch. Publishing without that would tell a veteran they qualify on a test we have not read.

  • Fee treatment of the Medal of Honor and other valor plates

    medium confidence it exists · Fla. Stat. §320.089 and the DHSMV fee schedule

    We publish the DV, accessibility, Purple Heart and Ex-POW plates and know that the Purple Heart plate is only free where the holder also qualifies under §320.084. The remaining military plates were never checked against that pattern, and the pattern is that the fee treatment differs between them.

    Still needed: A plate-by-plate reading of §320.089 against the current fee schedule. Guessing here is the failure the Purple Heart record exists to warn about.

  • Homestead property tax deferral

    medium confidence it exists · Fla. Stat. ch. 197, part III

    Deferral is not exemption — it postpones the bill against a lien on the home rather than removing it. For an older veteran whose exemptions do not reach far enough it can still be the difference between staying and selling, and no veteran benefits list carries it because it is not a veteran provision.

    Still needed: The income and age tests, the interest rate on deferred amounts, and how a deferral interacts with the veteran exemptions already granted on the same parcel. This is the same shape of find as §196.101, so it is worth the pass.

Texas — 9 on the worklist

Four research passes over Texas law. The third went outside the veteran chapters and found the over-65-or-disabled family — the extra school exemption, the school tax ceiling, and deferral at 5% with no foreclosure — which turns on Social Security disability rather than a VA rating. The fourth published the Fund for Veterans' Assistance with the correction that matters about it: the state grants to organisations and never to individuals. The smaller regional mobility authorities and the remaining metros are unread.

  • Veteran Toll Policies at the Remaining Regional Mobility Authorities

    high confidence it exists · Authority board policies under Tex. Transp. Code §372.053

    The second pass verified and published TxDOT, HCTRA, Fort Bend County, NET RMA and NTTA. Texas has further regional mobility authorities — Central Texas (CTRMA) around Austin, Cameron County (CCRMA) in the Valley, and others — each with the same §372.053 power to run a discount programme or not.

    Still needed: One verified record per authority. The pattern is now well understood: the questions are whether a programme exists, whether enrolment is required, and which facilities it covers.

  • Veteran Fares at the Remaining Texas Transit Authorities

    medium confidence it exists · Authority fare policies

    METRO, VIA and DART are published. Texas has substantial transit authorities in Austin (CapMetro), Fort Worth (Trinity Metro), El Paso (Sun Metro) and Corpus Christi among others, and El Paso in particular holds a large veteran population.

    Still needed: Current fare policy and required documentation for each.

  • School Tax Ceiling and Its Interaction with the Veteran Exemptions

    high confidence it exists · Tex. Tax Code §11.26, §11.261

    The age-65 and disability tax ceilings are not veteran-specific, which is why they are not in the corpus. But they interact with the veteran exemptions in ways that change the arithmetic, and a veteran over 65 with a partial exemption is affected by both.

    Still needed: A worked model of the interaction. Publishing the ceiling without modelling how it stacks would be worse than not mentioning it.

  • Military Retirement Pay Is Untaxed in Texas

    high confidence it exists · No statute — Texas levies no personal income tax

    Aggregators list this as a Texas veteran benefit. It is not one: Texas has no personal income tax at all, so military retirement is untaxed the same way every other kind of income is. We may want a myth-correction record saying exactly that, in the same spirit as the Florida toll record.

    Still needed: A decision on whether "this is not a veteran benefit" is worth a record here. It is arguably less misleading than the Florida toll myth because nobody is denied anything by believing it.

  • City Extensions of the Parking Exemption to Garages and Timed Bays

    high confidence it exists · Municipal ordinances under Tex. Transp. Code §681.008(c)

    The metered-parking exemption is statewide and we publish it. §681.008(c) lets a city extend it to garages, lots and time-limited spaces by ordinance — but does not require it. So the answer differs city by city across roughly 1,200 cities.

    Still needed: Ordinance research for the largest cities at minimum. Until then our record says correctly that meters are statewide and everything else is local.

  • Appraisal District Document Guidance for the Remaining 250 Counties

    high confidence it exists · District published guidance

    We hold captured guidance for four districts — Harris, Bexar, Travis and Williamson. The other 250 fall back to the statutory floor, which is a defined and correct answer, but district-specific guidance is more useful where it exists.

    Still needed: Systematic capture. Texas is better placed than Florida here because the Comptroller prescribes the forms statewide, so the variance is narrower — but it is 250 districts.

  • Which Texas Counties Actually Have a Veterans Service Officer

    high confidence it exists · Tex. Local Gov't Code §434.032

    Texas permits but does not require a commissioners court to appoint a County Veterans Service Officer. Many rural counties have none, and those are precisely the places where a digital product substitutes for absent human capacity rather than supplementing it.

    Still needed: A verified list. Florida's corpus records its CVSO gaps; ours records nothing because we could not verify it, and an unverified list would be worse than none.

  • State-funded caregiver support, respite or adult day health with a veteran route

    high confidence it exists · To be identified — Health and Human Services Commission; Texas Veterans Commission grant programme

    The state publishes an inventory of state-funded aging services and programmes, revised October 2025, which is exactly the document that would settle whether any of them is veteran-routed. It could not be read. The veterans commission also runs a page for veterans over 55 which may describe caregiver or respite grants funded through the veterans assistance fund already in this corpus.

    Still needed: https://www.hhs.texas.gov/sites/default/files/documents/inventory-state-funded-aging-services-program-fy2025.pdf answered HTTP 403 to a fetch on 23 August 2026 and https://www.hhs.texas.gov/services/health/medicaid-chip/programs/veteran-directed-care did the same. https://tvc.texas.gov/home/55plus/ returned an access-denied page with an error code. All three need a browser session.

  • Whether any utility discount, shutoff protection or weatherisation carries a veteran route

    medium confidence it exists · Tex. Util. Code; Public Utility Commission substantive rules

    This state has no utilities record. Whether the utility commission's customer protection rules carry any military-service condition, and whether the low-income electric discount that once existed has any successor with a veteran route, is unread.

    Still needed: The Public Utility Commission's own customer protection rules and the state energy assistance programme pages, read directly.

California — 2 on the worklist

Four research passes over California statewide law. The third found a whole missing layer — Vehicle Code §23301.3 exempts six veteran plate types from tolls statewide — and Property Tax Postponement. The fourth caught something that had gone stale under us: California taxed military retirement in full through three passes and stopped in 2025, and only re-reading the Franchise Tax Board's current publication found it. The local layer is still empty: 58 counties and over 480 cities, none researched.

  • Fee Treatment of California Valor and Award Licence Plates

    high confidence it exists · Cal. Veh. Code §5101.3 et seq.

    California issues Medal of Honor, Former Prisoner of War, Purple Heart, Legion of Valor and Pearl Harbor Survivor plates, and the fee treatment differs between them. The second pass published the Disabled Veteran plate and its §9105 fee exemption but did not resolve the others.

    Still needed: The section governing each plate and its fee treatment. Getting this wrong is the same failure the Texas Purple Heart record exists to correct, so we publish none of them until each is confirmed.

  • Transit Fares at the Large California Authorities

    medium confidence it exists · Authority fare policies

    LA Metro, BART, Muni, SANDAG and VTA between them serve most California veterans, and several publish veteran or disabled fares.

    Still needed: Current fare policy and required documentation for each. This is the obvious next local layer for California.

New York — 10 on the worklist

Four research passes over New York statewide law. The local-option gap that mattered most is half closed — county pages carry the state's own record of exemptions actually granted. The third pass added the pension buy-back and the Restoration of Honor Act. The fourth added the senior citizens exemption, which for an older veteran is usually worth more than the veterans exemption itself, and established that New York is the only state in this corpus with no statewide property tax deferral at all.

  • Which Maximum Each New York Locality Adopted

    high confidence it exists · RPTL §458-a(2)(d)

    The second pass closed most of this gap: we now hold the state's record of exemptions ACTUALLY GRANTED per county, which is direct evidence of adoption and is published on every county page. What remains is the other half — each locality selects a maximum from a statutory menu, and the granted-amount data does not reveal which one it chose.

    Still needed: The adopted maximum per taxing jurisdiction. Without it we can tell a veteran their county grants the exemption and what an average recipient receives, but not what their own ceiling is. That last step may only exist in local resolutions rather than in any state dataset.

  • New York City Property Tax Class Rates

    high confidence it exists · NYC Department of Finance

    DATA NOW IN HAND, design pending: the Department of Finance's own rates page was read via a rendered browser on 20 August 2026. Tax year 2026 final rates: Class 1 (one-to-three family homes) 19.843%, Class 2 (co-ops, condos, 4+ residential) 12.439%, Class 3 11.108%, Class 4 10.848% — with Class 1 assessed at 6% of market value and Class 2 at 45%. What remains is the design decision this candidate has always carried: NY's rate.basis is per $1,000 of market value, and these are percentages of ASSESSED value, so entering them raw would overstate a Brooklyn bill by the assessment ratio. Implement by converting class rate × assessment ratio into the effective market-value basis, then fill the five boroughs.

    Still needed: The NYC Department of Finance's own property tax rates page, giving all four class rates for the current fiscal year, whether they are the interim or the revised final rates, and the assessment ratio per class — plus a decision on how rate.basis should express a class-based rate, since the existing NY basis is per $1,000 and these are percentages of assessed value.

  • Real Property Tax Credit and STAR Interaction

    medium confidence it exists · N.Y. Tax Law §606(e)

    New York has a refundable property tax credit and the STAR exemption, neither veteran-specific but both interacting with the veterans exemptions on the same bill.

    Still needed: A worked model of how the three stack. Publishing one without the others would understate what a veteran actually pays.

  • Transit Fares at the New York Authorities

    medium confidence it exists · Authority fare policies

    The MTA is the largest transit system in the country and there are substantial authorities in Buffalo, Rochester, Syracuse and Albany.

    Still needed: Current veteran fare policy for each. The MTA's reduced-fare programme is age and disability based rather than veteran based, which needs care to describe accurately. The Syracuse authority runs a named Veteran Ride Pass programme with its own page on centro.org — attempted in a rendered browser on 22 August 2026, but navigation to centro.org failed outright from this environment (connection denied before any page loaded), so the programme's terms remain unread and unpublished.

  • PFC Joseph P. Dwyer veteran peer support programme

    high confidence it exists · State budget appropriation to the Office of Mental Health

    A state-funded veteran peer support programme run by the mental health office and expanded statewide with a named appropriation. It is the strongest behavioural health candidate in this state and nothing on it is published, because the mental health office's own programme page could not be located: every path tried under omh.ny.gov returned 404, and the veterans department's mental health pages returned 404 as well.

    Still needed: The mental health office's own Dwyer programme page, or the veterans department's mental health page, read directly. Tried and 404 this session: omh.ny.gov/omhweb/veterans/dwyer.html, /dwyer_program.html, /dwyer-peer-support.html, /dwyer/, /index.html; veterans.ny.gov/mental-health, /content/mental-health, /veteran-mental-health, /veterans-mental-health-and-wellness.

  • The rest of the state Soldiers' and Sailors' Civil Relief Act

    high confidence it exists · N.Y. Military Law §§302-319, notably 309, 311-A, 312, 313, 316 and 317

    The full section list of article 13 was read this session and four sections were read in full and published. The remainder are named but unread, and several are substantial: eviction restraint (309), termination of motor vehicle lease contracts (311-A), mortgages (312), settlement of stayed foreclosure or repossession proceedings (313), insurance policies not to lapse or be forfeited (316), and reemployment in private industry (317). Each is a publishable record in its own right and each sits on a host that answers.

    Still needed: The section pages, which answer readily: the pattern https://www.nysenate.gov/legislation/laws/MIL/<section> returned full statutory text for every section requested this session.

  • State veterans cemetery — dependent fee and the Executive Law article

    high confidence it exists · N.Y. Executive Law, the state veterans cemetery programme sections

    The cemetery is now published from the department's own page, which states eligibility and operations but tells families to telephone for the dependent burial fee. The Executive Law article establishing the state cemetery programme could not be resolved: section and article paths under nysenate.gov returned "the requested entry could not be found", and the Executive Law article index read this session does not list a veterans article at all.

    Still needed: The dependent fee, from the cemetery. And the correct Executive Law citation — the department's own published veterans' and servicemembers' laws booklet is the likeliest route and was identified but not opened this session.

  • Veteran route into utility discounts or energy assistance

    low confidence it exists · A public service commission order, or the state home energy assistance programme rules

    No state-mandated or commission-approved veteran utility discount, telephone or broadband supplement, or veteran priority inside the state home energy assistance programme has been read. Several attempts to reach a departmental benefits index this session returned 404, so the search was not exhausted.

    Still needed: A public service commission order or a state energy assistance page that names veterans. Tried and 404 this session: https://veterans.ny.gov/veteran-benefits, https://veterans.ny.gov/burial-benefits and https://veterans.ny.gov/burial.

  • The state veterans farmer grant fund

    high confidence it exists · Administered by the economic development agency with the agriculture department

    A state grant fund for farms at least fifty percent owned, operated and controlled by a veteran is described in state announcements, with a minimum farm income test and a grant range. None of it could be read from the administering agency this session, so nothing is published.

    Still needed: https://esd.ny.gov/new-york-state-veterans-farmer-grant-fund. That host returned 403 to a fetch and Access denied in a browser this session, twice, including after a wait. An agriculture department page carrying the current programme terms would also do.

  • The peer-to-peer veteran support programme funded through the counties

    high confidence it exists · State budget appropriation; county administration

    A county-delivered veteran peer support programme created in the 2012-2013 state budget is described as having expanded across the counties. No page on the state veterans department's own site describing it was reached this session, and the coalition site that documents it is not a state source.

    Still needed: A programme page on veterans.ny.gov, or the appropriation and any Veterans' Services Law section that governs it, read directly.

Pennsylvania — 10 on the worklist

Four research passes over Pennsylvania law. The fourth was a deep single-state pass through the DMVA programme layer: Veterans Temporary Assistance at $1,600, the Military Family Relief grant — now $5,000, though summaries still carry the old $2,500 and $3,500 caps — the fishing licence, whose tiers sit in different places from the hunting licence's, and the six state veterans homes. Geography is complete for all 67 counties; county tax rates and the local layer are not.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them — in one state, three transit operators drew the veteran line in three different places. Pennsylvania has 67 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Veteran-specific housing or home modification assistance

    low confidence it exists · To be identified

    Housing is the one category the Commonwealth corpus does not reach. Reading the DMVA state veterans programs index on 22 August 2026 showed why: everything it lists under housing and homelessness is general-population provision it refers veterans out to — the 211 affordable housing directory, the Department of Human Services homeless assistance and housing resources pages, and the Housing Finance Agency’s general programme list. None of those is a veterans benefit, and the corpus does not count general-population law as one. What is unresolved is whether the Housing Finance Agency runs any veteran-specific mortgage product or home modification grant behind that general index.

    Still needed: The Housing Finance Agency’s own programme pages, read for a veteran-specific product rather than a referral, before either publishing a record or recording a deliberate absence.

  • Pennsylvania consolidated statutes — every host refused this session

    high confidence it exists · 51 Pa.C.S.

    A research wall worth recording. Both hosts for the Pennsylvania statutes refused the connection outright on 23 August 2026: www.legis.state.pa.us and www.palegis.us each returned ECONNREFUSED to the fetcher, and the browser was denied navigation to both. That blocks 51 Pa.C.S. ch. 73, which appears to contain §7315 on termination of leases and similar obligations by military personnel, and 51 Pa.C.S. ch. 20 on burial of veterans. Both are exactly the kind of statutory record this corpus is thinnest on.

    Still needed: A working host for 51 Pa.C.S. Chapter 73 and Chapter 20, for the lease-termination notice rules and any burial allowance or headstone provision.

  • Utility assistance and any veteran route into it

    medium confidence it exists · Public Utility Commission programme policy

    DMVA’s own state veterans programmes index links utility assistance to the Public Utility Commission’s consumer education pages. puc.pa.gov refused the connection to the fetcher and was denied navigation at the browser this session, so whether LIHEAP, CAP, the hardship funds, LIURP or Lifeline carry any veteran eligibility route or priority could not be read at all.

    Still needed: The PUC utility assistance programmes page, for each programme’s income test and any veteran-specific eligibility or priority.

  • PA National Guard Survivors’ Pension and Survivors’ Tuition Waiver

    high confidence it exists · To be identified

    Both programmes are named on DMVA’s own state veterans programmes index, and both of the department’s own links to them return HTTP 404 on pa.gov — to the fetcher and to the browser alike. A monthly pension scaled by family composition and a tuition waiver for survivors are substantial benefits, and the department currently publishes no reachable page for either.

    Still needed: A working DMVA page for each programme, for the eligibility, the monthly amounts, the duration limit and the application route.

  • Attorney General material on servicemember consumer protections

    medium confidence it exists · To be identified

    DMVA routes pension-poaching complaints to the Office of Attorney General’s Military and Veterans Affairs section, but attorneygeneral.gov returned HTTP 403 to the fetcher and served a 403 page at the browser this session. Whether Pennsylvania has a state prohibition on charging for benefits assistance, and what state consumer statutes that section actually enforces for servicemembers, is unresolved.

    Still needed: The Attorney General’s military and veterans affairs pages, for the state statutes enforced and any accreditation or fee prohibition.

  • Transport to VA medical care

    medium confidence it exists · To be identified

    Nothing in the Pennsylvania corpus covers getting a veteran without a car to a VA appointment. The department’s veterans tree was read in full on 23 August 2026 and carries no transportation page — its answer to a veteran in difficulty is PA VETConnect, a referral network in all 67 counties, rather than a transport service. County directors of veterans affairs and volunteer driver networks are the likely home for this and none are researched.

    Still needed: A county director of veterans affairs’ own transport page, or a Veterans’ Trust Fund grant award funding transport — read, not summarised.

  • Beginning farmer and agricultural programmes with a veteran route

    medium confidence it exists · Pa.C.S. — to be identified

    The department’s veterans tree, read in full on 23 August 2026, names no agricultural programme. Whether the agriculture department runs a veteran route into beginning-farmer lending, land-link or agricultural fee concessions is entirely unresearched for this state.

    Still needed: The agriculture department’s beginning farmer and farm lending pages, read for a veteran-specific route rather than a general one.

  • The Veterans’ Trust Fund — what it funds and who may apply

    high confidence it exists · To be identified

    The fund surfaced twice in the same session, on 23 August 2026, as the money behind two different things: grants to charitable organisations and county directors of veterans affairs supporting a Veterans Courts Program, and grants supporting women veterans who are homeless, unemployed, facing mental health challenges or financial hardship. It is not a benefit a veteran applies for directly, but it decides which local services exist — and it has no record and no candidate in this corpus.

    Still needed: The department’s Veterans’ Trust Fund pages, for the grant categories, who may apply, the award cycle, and whether an individual veteran can ever be a beneficiary rather than an organisation.

  • The fishing licence section, on a Commonwealth host

    high confidence it exists · 30 Pa.C.S. §2707

    The published record now cites §2707 with no link, because the reproduction it was built on was dropped on 23 August 2026. Two claims in it are not in the Fish and Boat Commission fact sheet that replaced the mirror as the readable source: the one-dollar price for the reduced licence, and the former-prisoner-of-war route into that reduced tier. The fact sheet answers eight eligibility questions purely on the VA rating and never mentions prisoners of war or a price.

    Still needed: The section text on a Commonwealth host, or a Commission fee schedule naming the reduced-licence price. Tried 23 August 2026: https://www.legis.state.pa.us/cfdocs/legis/LI/consCheck.cfm?txtType=HTM&ttl=30&div=0&chpt=27&sctn=7&subsctn=0 and the bare host both refused the connection, https://www.palegis.us/statutes/consolidated refused it as well, and a browser navigation to palegis.us was denied at the navigation layer. https://www.pacodeandbulletin.gov/ answers normally but carries the Pa. Code, not the consolidated statutes — Title 58 is the Commission’s regulations and may carry the fee, which is the most promising untried route. Every guessed Commission licence-fee path under https://www.pa.gov/agencies/fishandboat/fishing/buy-license returned 404; find the real path from the agency landing page rather than guessing.

Illinois — 9 on the worklist

Five research passes over Illinois law. The fifth added the DV plates from the statute after ilsos.gov 403'd for two days: registration free, and the 50% route needs no mobility certification — that belongs to the sub-50% door only.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    The local layer is now OPEN for this state: the flagship metro transit fare is published. Remaining: every other transit authority, county and municipal programme (park passes, utility discounts, local tax add-ons) - the layer is a permanent workstream, not a single record.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas. One county Veterans Assistance Commission is now published as a worked example; the remaining counties, and which of them run a commission at all, are unresearched.

  • Filing deadlines and statutory basis for the war participation bonuses

    medium confidence it exists · ILCS section not identified

    The bonuses are published with their amounts and medal conditions, but the veterans department's page carries no ILCS citation and no filing deadline for any of the five. A closed window would make the published record misleading for some periods, so this matters.

    Still needed: The enabling ILCS sections. The state legislature's own server (ILGA) refuses connections, so the statute could not be read this session by any route.

  • National Guard grant — the commission’s own terms

    high confidence it exists · 110 ILCS 947 and 23 Ill. Adm. Code 2730

    The grant itself is now published from the veterans department's page, but the administering student assistance commission's own pages return 403 to every automated fetch. The number of semesters or units of eligibility, whether graduate study is covered, and the statutory and administrative code citations are therefore unread.

    Still needed: The commission's programme overview and eligibility pages. Blocked this session with 403: https://www.isac.org/isac-gift-assistance-programs/illinois-national-guard-grant/ing-grant-program-overview.html and https://www.isac.org/students/before-college/financial-aid-planning/scholarships-grants/illinois-national-guard-ing-grant.html.

  • State Service Member Civil Relief Act and Service Member Residential Property Act

    high confidence it exists · 330 ILCS 63 (Service Member Civil Relief Act); 330 ILCS 62 (Service Member Residential Property Act)

    Both acts exist and were confirmed to exist from search result titles carrying the legislature's own URLs. Together they are the whole of this state's consumer and legal protection layer for a service member — lease termination, contract cancellation, interest treatment and residential property protection — and not one section of either could be read. This is the single largest unread block of statute in this state's corpus.

    Still needed: The section text from the legislature. Blocked this session by BOTH routes: an automated fetch of https://www.ilga.gov/legislation/ilcs/ilcs3.asp?ActID=3420&ChapterID=33 and of https://www.ilga.gov/documents/legislation/ilcs/documents/033000630K45.htm returned ECONNREFUSED, and a live browser navigation to https://www.ilga.gov/Legislation/ILCS/ilcs3?ActID=3420&ChapterID=33 was refused outright. Try a state law library or the department's own protections poster published under 20 ILCS 2805/40, which was identified but not located this session.

  • Sunset state veterans cemetery — eligibility criteria and fee schedule

    high confidence it exists · 20 ILCS 2805 (Department of Veterans' Affairs Act)

    The cemetery is now published as existing, with interment and perpetual care for eligible veterans and spouses. What is NOT published anywhere on the department's site is who is eligible, what a veteran or a spouse pays, whether capacity remains, or how a burial is arranged. A family has to telephone for every one of those, which is a poor answer for the state's only veterans cemetery.

    Still needed: A department page or regulation stating cemetery eligibility and fees. Read this session and silent on all of it: https://veterans.illinois.gov/services-benefits/homes/quincy.html and https://veterans.illinois.gov/services-benefits/survivor-burial.html.

  • Utility discount or a veteran route into state energy assistance

    low confidence it exists · 305 ILCS 20 (Energy Assistance Act) or a commerce commission tariff

    The county veterans assistance commissions pay utility bills by voucher and that is already published, but no state-mandated or commission-approved veteran utility discount, no telephone or broadband supplement and no veteran priority inside the state energy assistance programme has been read. Utilities remain one of the thinnest categories corpus-wide.

    Still needed: A commerce commission tariff or a state energy assistance page that names veterans. The department's published benefits guide was downloaded and read in full this session and contains no utility or energy provision at all.

  • The statute text behind the veterans court and the women veterans division

    high confidence it exists · 730 ILCS 167 and 20 ILCS 2805

    Three records were added for this state this session and none is sourced from a statute, because the General Assembly's statute server could not be reached. The eligibility gates and exclusions for the veterans court, and the statutory basis for a women veterans division, are therefore unread.

    Still needed: ilga.gov. A fetch of https://www.ilga.gov/Documents/legislation/ilcs/documents/073001670K20.htm failed with ECONNREFUSED, and a browser navigation to ilga.gov was denied outright, this session. A different primary route into the ILCS is needed.

  • The Vehicle Code section behind the free disabled veteran plate

    high confidence it exists · 625 ILCS 5/3-609

    The published record now stands on the veterans department benefits guide, which describes only the physician-certification door. The section is understood to carry a second door — a service-connected rating of 50% or more, for a veteran whose disability does NOT qualify for a disability plate, giving a free registration plate on one vehicle — and to set the fee for a second set of plates. Neither the second door nor the second-plate fee has been read on a state host, so both are flagged in the record rather than asserted.

    Still needed: The section text on a state host, or the Secretary of State plate-guide pages. Tried 23 August 2026 and blocked on every route: https://www.ilga.gov/legislation/ilcs/fulltext.asp?DocName=062500050K3-609 and the http form of the same URL both returned connection refused; a browser navigation to ilga.gov was denied at the navigation layer; https://www.ilsos.gov/departments/vehicles/license-plate-guide/military/disabled-vet.html, the iserve variant of the same path, and https://www.ilsos.gov/publications/pdf_publications/vsd889.pdf all returned HTTP 403 to fetch and rendered "Access Denied" in the browser after an eight-second wait and a forced reload. www.cyberdriveillinois.com, the old Secretary of State domain, also 403s.

  • What completion of a veterans court programme earns

    high confidence it exists · 730 ILCS 167

    The judicial branch publishes which counties have a veterans court and how certification works, and that is what is now recorded. What graduation means for the underlying case is not published on any judicial branch page read this session.

    Still needed: The Act itself, or a certified court's own participant handbook, read directly.

Ohio — 13 on the worklist

Four research passes over Ohio law. The fourth added the examination credit — twenty per cent of the grade, proportional rather than a handful of points, and the largest employment preference in this corpus. Geography is complete for all counties; county tax rates and the local layer are not.

  • Ohio National Guard Scholarship Program — the state tuition benefit for serving Guard members

    high confidence it exists · Ohio Rev. Code §5919.34; Ohio National Guard Scholarship Program regulations

    The Guard tuition benefit is the largest state education benefit an Ohio Guard member has, and the corpus carries nothing on it. Reported terms — 100% of tuition at participating public institutions, the state public college average rate at approved private ones, 96 units for a six-year enlistment and 48 for three to five years — are unverified.

    Still needed: The Ohio National Guard’s own ONGSP pages. Tried 23 Aug 2026: https://www.ong.ohio.gov/members/ong/education/index.html and https://www.ong.ohio.gov/members/ong/education/ongsp/index.html both return “Request Rejected” to direct retrieval AND to browser navigation — the host blocks both. codes.ohio.gov, which would carry §5919.34, refused the connection again. A different official mirror of the Revised Code, or an ONGSP PDF served from dam.assets.ohio.gov, is the way in.

  • Free recording of a DD-214 with the county recorder

    high confidence it exists · Ohio Rev. Code §317.24

    The department’s own benefits guide tells veterans to record their discharges with the county recorder so a certified copy exists when a benefit needs verifying, but says nothing about the fee, about confidentiality, or about who may later obtain a copy. Those three facts are the whole of what makes the errand worth making.

    Still needed: The text of Ohio Rev. Code §317.24, or an Ohio county recorder’s own military discharge page. Tried 23 Aug 2026: codes.ohio.gov refused the connection; https://recorder.franklincountyohio.gov/services/military-discharge redirects to https://franklincountyohio.gov/Agency-Directory/Recorder which returned HTTP 403. Another county recorder’s page, or an official mirror of the Revised Code, is the way in.

  • Military Injury Relief Fund — the statute and the administrative rule behind the $500 grant

    high confidence it exists · Ohio Rev. Code §5902.05 (formerly §5101.98); Ohio Admin. Code rule 5902-8-02

    The published MIRF record rests entirely on the department’s own page and brochure. The rule is where the grant amount, the first-come-first-served allocation, the three-grants-per-lifetime structure and the appeal procedure are actually set, and none of it is verified against the rule text.

    Still needed: The text of Ohio Rev. Code §5902.05 and Ohio Admin. Code rule 5902-8-02. Tried 23 Aug 2026: https://codes.ohio.gov/ohio-administrative-code/rule-5902-8-02 and https://codes.ohio.gov/orc/5902.05 — codes.ohio.gov refused retrieval, as it has in every prior session. An official mirror of the Administrative Code is the way in.

  • Ohio Rev. Code ch. 5901 — the statutory frame for county veterans service commission financial assistance

    high confidence it exists · Ohio Rev. Code ch. 5901, especially §§5901.01–5901.15

    The financial assistance record we publish rests on the department’s own pages and one county commission’s page, not on the chapter. The chapter is reported to set the eligible relationships (veteran, active-duty member, spouse, surviving spouse, dependent parent drawing VA compensation, minor child or ward), a three-month county residency condition, the duty on commissions to adopt rules granting immediate assistance, and a county levy ceiling of five-tenths of a mill. None of that is verified against the text.

    Still needed: The text of Ohio Rev. Code §§5901.01–5901.15 and of the Ohio Administrative Code standards for the assistance. Tried 22 Aug 2026: https://codes.ohio.gov/ohio-revised-code/section-5901.15 and https://codes.ohio.gov/ohio-revised-code/chapter-5901 — direct retrieval returned ECONNREFUSED, and browser navigation to codes.ohio.gov was denied outright. A different official mirror of the Revised Code, or the Ohio Administrative Code chapter on veterans assistance standards, is the way in.

  • Ohio Rev. Code §§5901.25–5901.32 — the indigent veteran burial chapter, the headstone duty and the marker-setting expense

    high confidence it exists · Ohio Rev. Code §§5901.25, 5901.27, 5901.31, 5901.32, and the grave registration duty around §5901.34

    The published indigent burial record rests on two county commissions’ own documents and on the department’s digest of Attorney General opinions, not on the chapter. The chapter is reported to require the commission to contract at a fair and reasonable price with the funeral director the family selects, to satisfy itself beyond a reasonable doubt about want of means, to apply to the federal government for a suitable headstone for an indigent veteran and cause it to be placed, and to pay the necessary expense of placing and setting permanent and temporary markers. None of that is verified, and no statewide dollar ceiling has been read either way.

    Still needed: The text of Ohio Rev. Code §§5901.25 to 5901.34. Tried 23 Aug 2026: https://codes.ohio.gov/ohio-revised-code/section-5901.25 returned ECONNREFUSED, as codes.ohio.gov has in every prior session; https://www.legislature.ohio.gov/laws/ohio-revised-code/section?section=5901.25 also returned ECONNREFUSED; https://codes.ohio.gov/assets/laws/administrative-code/authenticated/4901/1/18/4901$1-18-12_20221124.pdf was tried to test whether the authenticated-PDF path on the same host behaves differently and it refused too. An official mirror of the Revised Code, or a county veterans service commission that publishes its own burial policy with the statutory duties quoted, is the way in.

  • Ohio’s own service member civil relief sections — §1343.031, §1349.02 and §1349.03

    high confidence it exists · Ohio Rev. Code §§1343.031, 1349.02, 1349.03, with "active duty" defined by reference to §5919.29 and §5923.21

    Three published records now rest on the Ohio Judicial Conference’s bench aid rather than on the sections themselves. The bench aid gives the headline of each — a 6% ceiling on interest and finance charges not confined to pre-service debt, vehicle lease termination on a 180-day deployment with no overseas requirement, mobile phone contract termination on deployment, all reaching spouses — but not the notice a consumer must give, the definition of "deployed", the treatment of prepaid amounts or fees, or the remedies for a creditor who refuses.

    Still needed: The text of Ohio Rev. Code §§1343.031, 1349.02 and 1349.03. Tried 23 Aug 2026: codes.ohio.gov returned ECONNREFUSED on every path; https://www.legislature.ohio.gov/laws/ohio-revised-code/section?section=5901.25 established that legislature.ohio.gov refuses the connection as well; https://www.lsc.ohio.gov/ (which publishes the bill analyses that would explain these sections) also returned ECONNREFUSED. The Ohio Attorney General’s own servicemember pages would be the alternative and https://www.ohioattorneygeneral.gov/Individuals-and-Families/Veterans and https://ohioattorneygeneral.gov/Individuals-and-Families/Veterans/Veterans-Legal-Assistance both returned ECONNREFUSED too.

  • Military status as a protected class in Ohio employment, housing and public accommodation

    high confidence it exists · Ohio Rev. Code §4112.02, with "military status" defined by reference to §5923.05

    The department’s own benefits guide states that Ohio law prohibits discrimination for military status in employment, housing and public accommodations, including against a disabled active duty person or veteran who needs a service animal. That is a protection the corpus has never carried, and it is enforced by charge to the Ohio Civil Rights Commission rather than by suing. The filing deadline, the covered areas and whether veteran status as distinct from current service is inside the definition are all unverified.

    Still needed: The Ohio Civil Rights Commission’s own pages, or Ohio Rev. Code §4112.02. Tried 23 Aug 2026: https://crc.ohio.gov/wps/portal/gov/crc/about-us/laws-and-rules 301-redirects to https://civ.ohio.gov/wps/portal/gov/civr/ which returns HTTP 404 to retrieval; https://civ.ohio.gov/how-to-file-a-charge/filing-a-charge/1filing-a-charge returns HTTP 404; the commission’s own "Did you know" PDF at https://civ.ohio.gov/wps/wcm/connect/gov/b4de906c-0a53-48d8-bb4f-8a85c112f8a1/Did+you+know+2023.pdf returns HTTP 404; codes.ohio.gov refused the connection. A commission PDF served from dam.assets.ohio.gov, which does answer, is the likeliest way in.

  • Protection for a deployed parent’s custody and parenting time

    medium confidence it exists · Ohio Rev. Code §3109.04 and the surrounding parenting time provisions

    Whether Ohio bars a court from treating deployment itself as a change of circumstances, provides expedited or remote hearings for a deployed parent, or allows parenting time to be delegated to a family member during a deployment is a protection families ask about constantly and the corpus carries nothing on it for any state. The Ohio Judicial Conference’s servicemembers bench aid, read this session, covers stays and default judgments but says nothing about custody.

    Still needed: Ohio Rev. Code §3109.04 text, or a Supreme Court of Ohio or Ohio Judicial Conference publication on deployed parents. Tried 23 Aug 2026: codes.ohio.gov refused the connection; the Ohio Judicial Conference bench aid at https://www.ohiojudges.org/cdn/Service-Member-Civil-Relief-Act-Bench-Aid.pdf was read in full and is silent on custody. A judicial conference bench card on military parents, or the Supreme Court of Ohio’s domestic relations forms guidance, is the way in.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    The local layer is now OPEN for this state: the flagship metro transit fare is published. Remaining: every other transit authority, county and municipal programme (park passes, utility discounts, local tax add-ons) - the layer is a permanent workstream, not a single record.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Certified veterans treatment dockets — the rule, the eligibility gate and the list of courts

    high confidence it exists · Ohio Sup.R. 36.20 to 36.26 and Appendix I to the Rules of Superintendence for the Courts of Ohio

    Ohio certifies specialized dockets for veterans through the Supreme Court of Ohio, and individual dockets are recertified on a term — a Van Wert municipal docket was recertified as recently as August 2026. What the certification standard requires, who is eligible, how long a term of certification runs, how many veterans dockets Ohio has and where they sit is the whole of the useful content, and none of it could be read.

    Still needed: The Supreme Court of Ohio Specialized Dockets Section pages, or the Ohio Rules of Superintendence Appendix I. Tried 23 Aug 2026: https://www.supremecourt.ohio.gov/JCS/specDockets/veterans/ and https://www.supremecourt.ohio.gov/courts/services-to-courts/specialized-docket-section/certification-procedures/ both returned ECONNREFUSED to direct retrieval, and browser navigation to supremecourt.ohio.gov was denied outright; https://www.courtnewsohio.gov/happening/2026/VanWertSpecializedDocket_081426.asp (the Supreme Court of Ohio own news service) also returned ECONNREFUSED; https://cp.cuyahogacounty.gov/court-information/court-news/posts/veterans-treatment-court-earns-recertification/ timed out. A common pleas court that publishes its own veterans docket handbook is the way in.

  • The statutory duty on county veterans service commissions to transport veterans to medical facilities

    high confidence it exists · Ohio Rev. Code Title 59, chapter 5901; the Ohio Administrative Code standards for commission programmes

    Four county commissions were read this session and all four attribute their transport programme to Title 59 — one naming ORC 5901 directly. What the chapter actually requires is unread: whether transport is mandatory or permissive, whether a commission may charge, whether an ambulatory requirement is lawful, and whether a commission must serve a veteran of another county. The published record rests on four counties describing their own duty.

    Still needed: The text of Ohio Rev. Code chapter 5901 and the Ohio Administrative Code standards. Tried 23 Aug 2026: codes.ohio.gov refused the connection again, as it has in every prior session; legislature.ohio.gov refused it in the previous session. A county commission publishing its transportation policy with the statutory duty quoted, or an official mirror of the Revised Code, is the way in.

  • The women veterans licence plate — fee, proof and whether it is gratis

    high confidence it exists · Ohio Rev. Code §4503.xx (the specialty plate section for women veterans plates)

    The Department of Veterans Services confirms the Bureau of Motor Vehicles issues specialty plates dedicated to women veterans, available to women veterans and to women currently serving. What it costs, what proof is required and whether it falls inside Ohio gratis or free military plate categories is the whole of what a veteran needs, and none of it could be read.

    Still needed: The Ohio BMV military plate pages. Tried 23 Aug 2026: https://www.bmv.ohio.gov/military-veteran-license-plates.aspx returned "The requested URL was rejected" to direct retrieval and browser navigation to bmv.ohio.gov returned "Request Rejected"; https://dam.assets.ohio.gov/image/upload/publicsafety.ohio.gov/bmv4507.pdf was fetched and read in full and is the gratis and free military plate application, which does not name a women veterans plate. The BMV specialty plate general information page at /vr-sp-geninfo.aspx, or a deputy registrar publishing the fee schedule, is the way in.

  • The examination credit section, on a state host

    high confidence it exists · O.R.C. §124.23, §124.26 and O.A.C. 123:1-9-01

    The published record — the largest employment preference in this corpus at twenty per cent of the examination grade — now cites §124.23 with no link at all, because the reproduction it was built on was removed on 23 August 2026 and nothing on a state host replaced it. Three things need the primary. Whether the fifteen per cent reserve figure and the residency requirement still read as recorded; what §124.26 does on the eligible list, which the record flags but does not model; and whether the Department of Administrative Services rule at O.A.C. 123:1-9-01 adds a filing procedure beyond "before the examination".

    Still needed: O.R.C. §124.23 on a state host. Tried 23 August 2026 and all blocked or silent: https://codes.ohio.gov/ohio-revised-code/section-124.23 refused the connection to a fetch (ECONNREFUSED on 198.234.74.32:443) and a browser navigation to codes.ohio.gov was denied at the navigation layer — the same behaviour recorded against this host in earlier sessions, so treat it as permanent rather than intermittent. The administrative code rule sits on the same host and is equally unreachable. Readable but silent on the credit: das.ohio.gov (every guessed veterans and state-employment path returns 404, and there is no site search), and the Department of Veterans Services benefits guide at https://dam.assets.ohio.gov/image/upload/dvs.ohio.gov/benefits/benefitsguide-0613edit.pdf, which was fetched and read in full — its employment chapter covers USERRA, ESGR, vocational rehabilitation, apprenticeships and the jobs centres, and never mentions the civil service credit. dam.assets.ohio.gov itself answers normally, so a DAS-authored PDF hosted there is the most promising untried route.

Georgia — 13 on the worklist

Five research passes over Georgia law. The fifth added the free veteran plate — no registration, manufacturing or annual fee — whose gate is being an honorably discharged veteran, not being disabled.

  • O.C.G.A. §38-1-1 — the statutory basis for free vital records for a veterans claim

    high confidence it exists · O.C.G.A. §38-1-1

    The published record establishes the waiver from the Department of Veterans Service’s own special-provisions page and the fee it removes from the Department of Public Health’s fee schedule. What the statute itself says — who may request in writing, whether divorce records are included on the same terms, and how a county official on a fee basis is reimbursed — is unverified.

    Still needed: The text of O.C.G.A. §38-1-1 from an official Georgia host. Tried 23 Aug 2026: rules.sos.ga.gov serves administrative rules but not the Code; https://dph.georgia.gov/ways-request-vital-record/fees carries no waiver at all; https://georgia.gov/request-vital-records is silent on it; https://www.bryancountyga.gov/government/courts/probate-court/vital-records returned HTTP 403. A Georgia county probate court or clerk page that quotes the section, or an official Code host, is the way in.

  • O.C.G.A. §§40-5-36 and 40-5-103 — the veteran driver licence and identification card

    high confidence it exists · O.C.G.A. §§40-5-36, 40-5-103; Ga. Comp. R. & Regs. R. 375-3-1-.16

    The published licence record rests on two agencies’ own pages. The statute is where the definition of a qualifying veteran, the treatment of a medical discharge and the fee exemption itself actually sit, and the administrative rule is where the documentary standard sits.

    Still needed: The text of O.C.G.A. §40-5-36 and of Ga. Comp. R. & Regs. R. 375-3-1-.16. Tried 23 Aug 2026: https://rules.sos.ga.gov/GAC/375-3-1-.16 renders only the rule title and navigation, with the body behind a download; https://dds.georgia.gov/media/6761/download returns a PDF whose text could not be extracted. The rule’s download served as text, or an official Code host, is the way in.

  • State parks discount card — how the 25 percent reduction is actually obtained

    high confidence it exists · O.C.G.A. §12-3-9.1

    The Department of Veterans Service states the 25 percent reduction and that it runs through a discount card. Nothing published says where the card is applied for, what it costs, how long it lasts, or whether camping and lodging are inside or outside it — and the last of those is what decides whether the benefit is worth anything to a family.

    Still needed: The state parks system’s own discount page and application. Tried 23 Aug 2026: https://gastateparks.org/discounts and https://gastateparks.org/AnnualParkPass both returned HTTP 403. A Department of Natural Resources page on gadnr.org, or the parks discount form, is the way in.

  • National Guard Service Cancelable Loan — the service cancellation and early separation terms

    high confidence it exists · Georgia National Guard Service Cancelable Loan Program Regulations 3300

    The published record establishes eligibility and the award table but not the thing that makes it a loan: how much service cancels how much of the balance, what interest runs if it is not cancelled, and what happens on separation before the obligation is served. A member signing without those terms is signing a debt.

    Still needed: The Georgia Student Finance Commission’s programme regulations. Tried 23 Aug 2026: the eligibility and award pages at gafutures.org read but neither states the cancellation terms, and https://gsfc.georgia.gov/document/document/2026-gng-scl/download was not retrieved as text. The regulations document served as text is the way in.

  • A state-run emergency or hardship assistance fund for veterans

    low confidence it exists · Unknown — no O.C.G.A. provision identified

    Most states in this corpus run some emergency relief or hardship fund for veterans, administered either by the state department or by counties. Searching for a Georgia equivalent on 22 Aug 2026 surfaced only charitable and federal programmes — service organisation relief funds, a diocesan assistance programme, federal supportive services grants — none of them state-administered. The Department of Veterans Service’s own services index at https://veterans.georgia.gov/services lists benefits assistance, appeals, education, nursing homes, memorial cemeteries and suicide prevention outreach, and no financial assistance programme at all.

    Still needed: Confirmation either way: a state programme we have not found, or a positive finding that Georgia routes hardship cases to charitable partners rather than running its own fund. The Georgia Veterans Service Foundation is the most likely place a state-adjacent fund would sit and has not been researched.

  • Child custody and visitation where a parent deploys — O.C.G.A. §19-9-3(f) and (i)

    high confidence it exists · O.C.G.A. §19-9-3

    This is the protection a deploying parent most needs and it is the one Georgia’s own consumer-facing material does not carry. Leads read on 23 Aug 2026 indicate that deployment absences may not by themselves support a custody modification, that a final order altering a pre-deployment parenting plan is deferred until after the deployment ends unless the service member agrees earlier, that the pre-deployment plan carries a presumption in the child’s best interests, and that a deployed parent may give testimony by electronic means. None of that is publishable on what we read: every route to it this session was a secondary source.

    Still needed: The text of O.C.G.A. §19-9-3, specifically subsections (f) and (i), from an official Georgia host — or a Georgia judicial branch page that sets it out. Tried 23 Aug 2026: https://www.legis.ga.gov/legislation/54595 renders only a loading shell, the General Assembly site being a script-driven application WebFetch cannot read; https://law.justia.com/codes/georgia/title-38/chapter-4/ returned HTTP 403 and is a secondary host in any case; https://consumer.georgia.gov/consumer-topics/military-consumer-protection-resource-page and https://consumer.georgia.gov/consumer-topics/military-debt-relief are both silent on custody. A georgiacourts.gov page, or the General Assembly’s bill-text PDF served directly, is the way in.

  • O.C.G.A. §§44-7-22, 44-7-37 and 46-5-8 — the statutory text behind the military termination rights

    high confidence it exists · O.C.G.A. §§44-7-22, 44-7-37, 46-5-8; 2019 Ga. Laws (House Bill 25)

    Two published records rest on the Attorney General’s Consumer Protection Division pages rather than on the Code. The statute is where the definition of "service member" sits — including the 90-day ordered-federal-duty test and whether the Georgia National Guard and Air National Guard are inside it — along with the anti-waiver provision and the documentary standard for the notice. The 2019 Act is where the codified list of covered contract types sits.

    Still needed: The text of O.C.G.A. §§44-7-22, 44-7-37 and 46-5-8, and of House Bill 25 as enacted in 2019, from an official Georgia host. Tried 23 Aug 2026: https://www.legis.ga.gov/legislation/54595 returns a loading shell only; http://www.legis.ga.gov/Legislation/en-US/display/20192020/HB/25 was surfaced as a lead but the site is script-driven; https://consumer.georgia.gov/document/document/galandlordtenanthandbookpdf/download is a PDF whose text could not be extracted. The General Assembly’s bill-text PDF served directly, or the landlord-tenant handbook as text, is the way in.

  • County duty to bury an indigent decedent — O.C.G.A. §36-12-5, and whether a veteran route sits alongside it

    medium confidence it exists · O.C.G.A. §36-12-5

    Burial is the corpus’s largest gap and Georgia’s answer appears to be a county duty rather than a state programme. Leads read on 23 Aug 2026 point to a county obligation, where the decedent and immediate kindred are indigent, to make county funds available for a decent interment or cremation, administered county by county through the human services division, with the sum varying by county. That is not veteran specific and none of it was read from an official Georgia source, so nothing is published.

    Still needed: The text of O.C.G.A. §36-12-5 from an official Georgia host, plus a Georgia county’s own published indigent burial policy giving the allowance figure and the indigency test — and confirmation either way of whether any veteran-specific county burial allowance, headstone-setting reimbursement or grave registration duty exists. Tried 23 Aug 2026: https://www.fultoncountyga.gov/-/media/Departments/Medical-Examiner/Fulton_County_Indigent_Burial_Policy_Manual_05-15-2012.pdf is a PDF whose text could not be extracted; https://veterans.georgia.gov/ocga-references lists no burial section at all; the Department of Veterans Service benefits book at https://veterans.georgia.gov/document/document/2024-georgia-veterans-benefits/download would not render as text. A county DFCS or coroner page giving the figure is the way in.

  • Full-service fuel at the self-service price — the statutory basis and whether a refusal carries a penalty

    high confidence it exists · Unknown — the Department of Veterans Service names no section against it

    The published record carries the duty in the department’s own words, including the two provisos. What is unknown is where it sits in the Code, whether any penalty attaches to a station that refuses, and whether the duty reaches a station that offers assisted service under some other name. A duty with no enforcement route is worth less than it looks, and a veteran should know which it is.

    Still needed: The O.C.G.A. section behind the motor fuel provision. Tried 23 Aug 2026: https://veterans.georgia.gov/ocga-references lists sections for the plates, the parking provision and the park fee reduction but names none against motor fuel; https://veterans.georgia.gov/other-special-state-provisions states the duty without a citation. A Department of Agriculture or Safety Fire Commissioner fuel-dispensing rule on rules.sos.ga.gov is the likeliest home for it.

  • Veteran discounts at municipal utilities and electric membership corporations

    low confidence it exists · Local ordinance or cooperative tariff

    The published absence record establishes that the Public Service Commission’s regulated utilities carry no veteran route — three official pages enumerating the criteria were read on 23 Aug 2026 and none names one. What that finding does not cover is the utilities the commission does not regulate: city-owned electric, gas and water systems, and the electric membership corporations. Those set their own terms and are where a veteran discount, if one exists anywhere in Georgia, would sit.

    Still needed: Tariff or ordinance research at the larger municipal systems and at the electric membership corporations, starting with the metropolitan areas. Nothing was tried this session: the state-regulated layer was the scope.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them — in one state, three transit operators drew the veteran line in three different places. Georgia has 159 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • The statutory basis for the GDVS Women Veterans Office

    medium confidence it exists · O.C.G.A. title 38, ch. 4 (Department of Veterans Service) — section unidentified

    The published Women Veterans Office record rests entirely on the department page. Whether the office, its director post and its military sexual trauma counselling function are created by statute — and therefore survive a change of administration — or exist as departmental practice is unverified, and it is the difference between a durable benefit and a discretionary one.

    Still needed: The text of O.C.G.A. title 38, ch. 4. Tried 23 Aug 2026: direct retrieval of veterans.georgia.gov returned HTTP 403 throughout and the pages were read in the browser instead; no free official host of the O.C.G.A. was located — the Georgia General Assembly links to a commercial publisher. The Council of Accountability Court Judges publishes individual O.C.G.A. sections as PDFs at cacj.georgia.gov/media/, which is how § 15-1-17 was read this session; a comparable state-agency mirror of the title 38 sections is the way in.

  • The annual list of certified veterans court divisions

    high confidence it exists · O.C.G.A. § 15-1-17(b)(4)(D)

    The statute requires the Council of Accountability Court Judges to publish an annual report listing certified veterans court divisions on or before 1 September each year. That list answers the only question a defendant actually has — is there one where I am charged — and the published record cannot answer it.

    Still needed: The Council of Accountability Court Judges annual report. Tried 23 Aug 2026: https://cacj.georgia.gov/standards-certification/certification-instructions-applications/apply-veterans-treatment-court was read and points at georgiavtc.com, which the page says requires login credentials. The Council annual report PDF, likely under cacj.georgia.gov/media/, is the way in.

North Carolina — 15 on the worklist

Four research passes over North Carolina law. The fourth added the employment preference, which is not a points system — it applies again at promotion, transfer and reduction in force, and it reaches peacetime service-connected disability despite the wartime headline. Geography is complete for all counties; county tax rates and the local layer are not.

  • N.C.G.S. §§47-113 and 47-113.2 — recording a discharge and the access restriction

    high confidence it exists · N.C.G.S. §§47-113, 47-113.2

    The published record rests on a register of deeds’ own statement of practice. Whether the statute itself sets the fee at nil, the exact statutory list of authorised parties, and whether the in-person filing requirement is statutory or local practice are all unverified.

    Still needed: The text of N.C.G.S. §§47-113 and 47-113.2. Tried 23 Aug 2026: https://www.ncleg.gov/EnactedLegislation/Statutes/HTML/BySection/Chapter_47/GS_47-113.2.html returned HTTP 403 and https://www.ncleg.net/EnactedLegislation/Statutes/PDF/BySection/Chapter_47/GS_47-113.2.pdf returned HTTP 403 — ncleg refuses both hosts, as in prior sessions. An official mirror of the General Statutes is the way in.

  • N.C.G.S. §116-209.50 — the statutory frame for the tuition assistance programme

    high confidence it exists · N.C.G.S. §116-209.50; article 15 of NC Senate bill 105

    The published NCTAP record carries the Guard’s own caps and windows. Whether those caps are statutory or administrative, and whether the two-year obligation and the repayment triggers are set by statute, is unverified — which matters because an administrative cap can move without notice.

    Still needed: The text of N.C.G.S. §116-209.50. Tried 23 Aug 2026: ncleg.gov and ncleg.net both returned HTTP 403 to direct retrieval. An official mirror of the General Statutes is the way in.

  • State veterans homes — admission eligibility, per-diem and application process

    high confidence it exists · N.C.G.S. ch. 165

    The published record establishes the four operating homes, the closure at Fayetteville, the clinical services and the insurance approvals. It carries no eligibility criteria, no per-diem and no application process, because the division publishes none — and those three are what a family actually needs before it phones.

    Still needed: The department’s own admission criteria and rate schedule. Tried 23 Aug 2026: https://www.milvets.nc.gov/services/nc-state-veterans-homes returns HTTP 404; https://www.milvets.nc.gov/divisions/north-carolina-state-veterans-homes and the veterans homes directory PDF carry locations and services only; https://www.milvets.nc.gov/benefits-services returns HTTP 404. An admission packet PDF, or N.C.G.S. ch. 165, is the way in.

  • State veterans cemetery interment — the statutory residency test and the family burial fee

    high confidence it exists · N.C.G.S. ch. 65 art. 8A, especially §65-43.1 (eligibility for interment)

    The cemetery record we publish carries no statutory residency test because we could not read one. The article is reported to confine interment to veterans who were legal residents of this state at the time of entry into the Armed Forces — a much narrower test than living here now, and one that would change who the record reaches. The burial fee charged for an eligible spouse or family member is likewise confirmed to exist but is published nowhere we could read.

    Still needed: The text of §65-43.1 and the division’s fee schedule. Tried 22 Aug 2026: https://www.ncleg.gov/EnactedLegislation/Statutes/PDF/ByArticle/Chapter_65/Article_8A.pdf returned HTTP 403; https://www.milvets.nc.gov/documents/files/cemetery-program/general-policy-guide/open downloads but its PDF text is CID-encoded and could not be extracted. A readable statute source or a cemetery fee page would close both gaps at once.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them — in one state, three transit operators drew the veteran line in three different places. North Carolina has 100 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • North Carolina state veterans homes — admission criteria and charges

    high confidence it exists · N.C.G.S. ch. 143B art. 13 (Department of Military and Veterans Affairs)

    The department runs four full-service state veterans homes with 449 skilled care beds across Black Mountain, Kernersville, Kinston and Salisbury (the Fayetteville home, 150 beds, is closed for structural repairs with residents relocated). The pages confirm the homes are licensed by the state and approved for Medicare, Medicaid and third party insurance, but publish no admission criteria, no residency test, no spouse provision and no rate.

    Still needed: A published admission-criteria or charges page. Read 22 Aug 2026 without finding them: https://www.milvets.nc.gov/divisions/north-carolina-state-veterans-homes and https://www.milvets.nc.gov/services/nc-state-veterans-homes. The department names a director of state veterans home operations for enquiries, which suggests the criteria are not published at all rather than merely hard to find.

  • N.C.G.S. §§42-45 and 42-45.2 — whether the state early lease termination right still reaches serving members

    high confidence it exists · N.C.G.S. §§42-45, 42-45.2; Session Law 2019-161

    Two state agency sources read 23 Aug 2026 disagree. The North Carolina Real Estate Commission’s bulletin describes §42-45 as reaching military personnel generally, with liquidated damages capped at one month’s rent under six months’ tenancy, half a month’s rent to nine months, and nothing after. The North Carolina State Bar’s military legal assistance article states the 2019 NC SCRA removed that right from active duty servicemembers and left it to a narrow class of military technician deploying 90 days or more. Only the statute settles it, and it decides whether a serving tenant has a state route at all.

    Still needed: The current text of §§42-45 and 42-45.2. Tried 23 Aug 2026: https://www.ncleg.gov/EnactedLegislation/Statutes/PDF/ByArticle/Chapter_65/Article_8A.pdf returned HTTP 403 and ncleg.gov refuses retrieval across the board, as in prior sessions; https://www.ncrec.gov/Brochures/HTML/militarybrochure.html returned HTTP 403 and https://www.nclamp.gov/publications/take-1/early-lease-termination-for-servicemembers-and-dependents/ returned HTTP 403. The UNC School of Government mirrors General Assembly statute PDFs at https://www.sog.unc.edu/sites/default/files/course_materials/ — a Chapter 42 article there would close this.

  • Custody and visitation protection for a deployed parent

    high confidence it exists · N.C.G.S. §50-13.7A; N.C.G.S. ch. 50A art. 3 (Uniform Deployed Parents Custody and Visitation Act)

    North Carolina is reported to bar temporary duty, mobilisation or deployment and the resulting disruption to a child’s schedule from counting as a change of circumstances on a motion to transfer custody away from the servicemember, to allow delegation of visitation to a family member with a close and substantial relationship to the child, and to require an expedited hearing where the motion is filed before deployment. Nothing in the corpus covers custody protection in any state, and this reaches a population no other record does.

    Still needed: The text of §50-13.7A and ch. 50A art. 3, or a North Carolina Judicial Branch page. Tried 23 Aug 2026: ncleg.gov refuses retrieval; the readable material found was a UNC School of Government faculty blog post and law firm commentary, neither of which may be a source on a published record. An nccourts.gov self-help page, or a School of Government mirror of the Chapter 50A Article 3 statute PDF, is the way in.

  • Whether VA disability compensation counts as income for state means-tested programmes

    medium confidence it exists · NCDHHS Division of Social Services policy manual (LIEAP and CIP)

    The published utilities record establishes that neither the Low Income Energy Assistance Program nor the Crisis Intervention Program carries a veteran preference, and that both turn on an income test — 130% and 150% of the federal poverty level. Whether VA disability compensation is counted in that income decides whether a rated veteran is inside or outside both programmes, and the same question runs through every other means-tested state benefit.

    Still needed: The DHHS energy assistance policy manual’s income definition. Read 23 Aug 2026 without finding it: https://www.ncdhhs.gov/assistance/low-income-services/low-income-energy-assistance references unearned income documentation without listing sources, and https://www.ncdhhs.gov/assistance/low-income-services/crisis-intervention-program states the 150% test without defining countable income.

  • County duty to bury an indigent veteran, and any county burial allowance

    low confidence it exists · N.C.G.S. ch. 65

    Several states impose a statutory duty on the county to bury an indigent veteran, with a reimbursement to the funeral home and a marker-setting allowance. Nothing found for North Carolina this session establishes such a duty, and the one county burial page read describes federal VA benefits only. It may not exist here — but a proven absence is worth as much as a find, and neither is established.

    Still needed: Either a Chapter 65 provision imposing the duty, or enough county veteran services pages to establish that no state-level duty exists. Read 23 Aug 2026: https://orangecountync.gov/1831/Burial-Benefits describes only federal VA burial allowances — up to $2,000 for a service-connected death, partial reimbursement otherwise, two-year filing limit for non-service-connected — and cites no state statute. ncleg.gov refuses retrieval.

  • State veterans cemetery — the dependant burial fee amount

    high confidence it exists · N.C.G.S. ch. 65 art. 8A; NCDMVA cemetery fee schedule

    Both cemetery brochures read 23 Aug 2026 confirm a burial fee exists for a spouse or dependant and neither publishes the figure. The Eastern Carolina policies brochure adds that it is subject to change at any time and cannot be pre-paid, which suggests it is set administratively rather than by statute — but that is inference, not a read fact, and a family planning a funeral needs the number.

    Still needed: A published fee schedule, or confirmation from the Director of State Veterans Cemeteries that none is published. Read 23 Aug 2026 without finding an amount: https://www.milvets.nc.gov/documents/files/cemetery-program/eligibility-guide/open, https://www.milvets.nc.gov/documents/files/cemetery-program/general-policy-guide/open and https://www.milvets.nc.gov/divisions/north-carolina-state-veterans-cemeteries. The division director is named on the last of these.

  • State certification or preference for veteran-owned businesses

    low confidence it exists · N.C.G.S. §§143-48, 143-48.4, 143-128.4

    RESOLVED AS AN ABSENCE, 23 Aug 2026 — see the published record nc-no-veteran-business-certification. The 2026 state budget eliminated the Office for Historically Underutilized Businesses and state government contracts stopped recognising HUB certifications on 7 July 2026; the NC Small Business Enterprise programme that carries on certifies on headquarters, net income, headcount and for-profit status alone, with no veteran criterion. What remains open is narrow: whether N.C.G.S. § 143-128.4 was itself repealed alongside the office, and what the Statewide Uniform Business Certification is worth to a veteran-owned firm with participating local governments until it expires.

    Still needed: The text of N.C.G.S. § 143-128.4 as it now stands, and the Division of Purchase & Contract guidance on what happens to existing Statewide Uniform Business Certifications. Tried 23 Aug 2026: https://www.ncleg.net/EnactedLegislation/Statutes/HTML/BySection/Chapter_143/GS_143-128.4.html returned HTTP 403 and browser navigation to ncleg.net returned a Cloudflare "Sorry, you have been blocked" page; ncleg.gov behaved identically. https://www.doa.nc.gov/businesses/historically-underutilized-businesses-hub and .../certifications/ncsbe were both read in full. The session law text of the 2026 budget is the way in.

  • North Carolina veterans treatment and recovery courts — statute, districts and eligibility

    high confidence it exists · N.C.G.S. ch. 7A, art. 62 (the Drug Treatment and Recovery Court Act, as it reaches veterans)

    Every other state researched this session has a readable veterans treatment court source. North Carolina has none that this network can reach, so the corpus carries nothing on which judicial districts run one, what the eligibility gate is, or what completion achieves.

    Still needed: The North Carolina General Statutes or the Judicial Branch recovery courts pages. Tried 23 Aug 2026: https://www.nccourts.gov/programs/recovery-courts returned HTTP 403 to direct retrieval, and browser navigation to nccourts.gov returned a Cloudflare "Sorry, you have been blocked" page that did not clear after an 8 second wait and a re-navigation; https://www.ncleg.gov/EnactedLegislation/Statutes/HTML/ByArticle/Chapter_7A/Article_62.html returned HTTP 403 and browser navigation to ncleg.net returned the same Cloudflare block. A county superior court that publishes its own veterans court handbook is the way in.

  • County transport for veterans to VA medical care

    medium confidence it exists · County ordinance; N.C.G.S. ch. 165 (veterans affairs)

    The state department says most counties in North Carolina offer veteran services and claims support, but says nothing about transport. Whether North Carolina counties run vans to the Durham, Fayetteville, Salisbury and Asheville VA medical centres — and on what terms — is unknown to this corpus, and it is one of the most-used services a veteran can be told about.

    Still needed: A North Carolina county veterans services office page publishing a transport programme, or N.C.G.S. ch. 165. Tried 23 Aug 2026: https://www.milvets.nc.gov/ was surveyed in full and carries no transportation page; https://www.milvets.nc.gov/veterans-service-centers was read and mentions county services without naming transport; ncleg.gov and ncleg.net both refused retrieval and browser navigation.

  • Whether the disabled veteran plate also carries the registration fee

    medium confidence it exists · N.C.G.S. §20-79.7 and §20-88

    The plate record used to state that a vehicle registered at 6,000 pounds or less pays no regular registration fee either. That came from a reproduction of §20-79.7(a) and was removed from the published record on 23 August 2026, because nothing on a state host repeats it. This matters more than the plate fee: the plate is a one-off saving, the registration fee is annual and recurring, so if the waiver is real it is the larger half of the benefit and it is currently unpublished.

    Still needed: N.C.G.S. §20-79.7 on a state host, or a Division of Motor Vehicles fee schedule that lists what a disabled veteran plate holder pays at renewal. Tried 23 Aug 2026, all blocked or silent: https://www.ncleg.gov/EnactedLegislation/Statutes/HTML/BySection/Chapter_20/GS_20-79.7.html and the PDF form of the same path both returned HTTP 403, and a real browser session got the Cloudflare interstitial "Sorry, you have been blocked" after an eight-second wait. Readable but silent on the point: https://www.milvets.nc.gov/benefits-services/military-and-veteran-license-plates, https://www.ncdot.gov/dmv/downloads/Documents/MVR-33A.pdf and https://www.ncdot.gov/dmv/offices-services/military/Pages/default.aspx. The DMV plate deep links under /dmv/title-registration/registration/ all 404; /dmv/title-registration/license-plates/Pages/specialty-plate-forms.aspx does resolve and is the next thing to mine.

Michigan — 12 on the worklist

Two research passes over Michigan law. The second added the Children of Veterans Tuition Grant, which carries a live GPA condition most survivor benefits do not. Geography is complete for all counties; county tax rates and the local layer are not.

  • Recreation — the statute behind the published waiver, and state park concessions

    high confidence it exists · MCL 324.43537

    The core waiver is now PUBLISHED (mi-dv-licences, 22 August 2026): a rendered browser session got through michigan.gov's 403 wall and read the DNR's own licence-information page, which states both routes (permanently and totally disabled at the 100% rate for a disability other than blindness, or individually unemployable), the residency requirement, the carry-your-documentation rule and the separate-application limit. What remains unread is the statute itself — legislature.mi.gov still sits behind a Check Point CloudGuard firewall — and the DNR page's 'does not require a separate application' phrasing is the department's gloss on the statute's lottery carve-out, so the exact licence list on each side of that line is unconfirmed.

    Still needed: A readable MCL 324.43537 confirming the statutory wording behind the published record and exactly which licences the separate-application/lottery carve-out removes; any state park or harbour concession (the DNR page covered licences only, not the Recreation Passport).

  • Disabled veteran plates, registration and licence fees

    high confidence it exists · To be identified

    Plate fee treatment differs between plate types within a single state, and reading it plate-by-plate is the discipline the Texas Purple Heart record exists to enforce.

    Still needed: A plate-by-plate reading against the current fee schedule.

  • Veterans preference in public employment

    high confidence it exists · To be identified

    Michigan runs one under Act 205 of 1897 (MCL 35.401-35.404) and Civil Service Commission Rule 3-8. A reproduction of Rule 3-8 gives specific criteria: an eligible veteran is someone with 90 or more calendar days of active duty and an honourable discharge; the preference also reaches a disabled veteran, a surviving spouse, the spouse of a disabled veteran rated over 50%, and a surviving spouse caring for a child under 18 or a disabled child; and crucially it may be used only for the INITIAL appointment to a position in the Michigan state classified service. We will not publish on that reproduction because it is a veterans organisation's summary, not the agency. legislature.mi.gov sits behind a Check Point CloudGuard WAF, michigan.gov returns 403, and law.justia.com returns 403.

    Still needed: A readable Civil Service Commission Rule 3-8 or MCL 35.401-35.404 from the State confirming the 90-day test, the six eligibility categories, the two-year residency requirement that Act 205 is reported to add, and the initial-appointment-only limit.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Michigan has 83 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • County-paid veterans burial allowance

    high confidence it exists · MCL 35.801 (Act 235 of 1911)

    Michigan law provides for a county payment towards the burial expenses of an eligible wartime veteran or their spouse, gated by an estate limit, a service test, a residency test and a two-year application deadline. The corpus now carries a published absence saying Michigan has no state veterans cemetery, and this allowance is the one thing that could sit alongside it — but the statute could not be read. legislature.mi.gov returned a Check Point CloudGuard WAF block page in the browser and a certificate error to the fetcher, and its render host presents a self-signed certificate. The Veterans Affairs Agency’s own burial page does not mention the allowance at all.

    Still needed: MCL 35.801 from a readable host, for the maximum allowance, the current estate limit, the service and residency tests, who may apply and the deadline after death.

  • One free certified vital record copy for a veterans benefit claim

    high confidence it exists · MCL 333.2891(6)

    Michigan charges a $34 search fee for a standard vital record, read at the Department of Health and Human Services ordering page on 23 August 2026. Alongside it there is reported to be a no-fee certified copy for a veteran securing a bonus, pension or compensation, marked "For Veterans Benefits Only, Not For Personal Use", with an heir or legal representative able to request it where the veteran is deceased or incompetent. The dedicated MDHHS page for it could not be opened: every path we tried under the vital records eligibility section returned 404 in the browser, the legacy URL 404s, the application PDF triggered a download rather than a page, and the statute host is behind a firewall block.

    Still needed: The MDHHS "Veteran's Benefits Copies" page or MCL 333.2891(6), for whether the free copy is limited to one, which record types it covers, what proof is required, and who may request on a deceased veteran's behalf.

  • County $300 burial expense — the residency and asset limits

    high confidence it exists · MCL 35.801 et seq.

    The $300 county burial expense is now published in this corpus from the Veterans Affairs Agency’s own summary page. That page states that residency and asset limits apply and publishes neither, names no filing deadline and names no form. legislature.mi.gov remains unreadable to us — its render host presents a certificate that cannot be verified — and the department’s own compilation of frequently used state laws at michigan.gov returned HTTP 403 to the fetcher and offered a file download rather than a page at the browser.

    Still needed: MCL 35.801 to 35.807 from a readable host, or a county veterans affairs office page stating the residency test, the asset limit, the deadline and the form.

  • The Michigan sections behind the servicemember protections

    high confidence it exists · MCL 32.517; MCL 445.1011 et seq.; MCL 500.2116a; MCL 570.521 et seq.; MCL 600.3185; MCL 600.3285

    Four Michigan protections are published in this corpus from the Attorney General’s own pages, and not one of the underlying sections could be read at source. legislature.mi.gov is unreadable to us. The unanswered questions are specific: the notice period under the Military Personnel Motor Vehicle Leasing Act, whether the auto-insurance protection reaches state active duty, and the exact trigger wording in MCL 32.517.

    Still needed: Any readable host for the Michigan Compiled Laws, for the six sections named above.

  • Veterans treatment courts

    high confidence it exists · MCL — to be identified

    Michigan runs veterans treatment courts among its problem-solving courts and nothing in this corpus records them. The judiciary’s own host, courts.michigan.gov, sat on a Cloudflare "Attention Required" challenge on 23 August 2026 and did not clear it across an eight-second wait and a forced reload — which is a different wall from the certificate failure that keeps the legislature host closed, and may respond differently from another route.

    Still needed: The judiciary’s problem-solving court pages, for which counties run a veterans docket, the eligibility gate, the statutory authority and what completion earns.

  • Transport to VA medical care

    medium confidence it exists · To be identified

    Nothing in the Michigan corpus covers getting a veteran without a car to a VA appointment. The veterans agency’s own site was read on 23 August 2026 and its navigation carries no transportation page; county veterans affairs departments and volunteer driver networks are the likely home for this and none are researched. The agency does publish a telehealth expansion effort with community partners, which is a different answer to the same problem and may be the more current one.

    Still needed: A county veterans affairs department’s own transport page, or the agency’s telehealth access programme — read, not summarised.

  • Beginning farmer and agricultural programmes with a veteran route

    medium confidence it exists · MCL — to be identified

    The veterans agency’s navigation, read on 23 August 2026, names no agricultural programme at all. Whether the agriculture and rural development department runs a veteran route into beginning-farmer support, farm lending or fee concessions is entirely unresearched for this state.

    Still needed: The agriculture and rural development department’s beginning farmer pages, read for a veteran-specific route rather than a general one.

  • State caregiver stipend, respite or adult day support with a veteran route

    medium confidence it exists · MCL ch. 35; Michigan Veterans Affairs Agency programme rules

    Not established either way. The Michigan Veterans Affairs Agency home page was read in a browser on 23 August 2026 and names no caregiver, respite or adult day programme among its benefits and resources; https://www.michigan.gov/mvaa/resources and https://www.michigan.gov/mvaa/resources/health-care both returned 404. legislature.mi.gov remains unreachable from this network, so MCL ch. 35 could not be searched for one.

    Still needed: An agency page for a Michigan caregiver or respite programme, or MCL ch. 35 read for a caregiver provision.

New Jersey — 9 on the worklist

Four research passes over New Jersey law. The fourth added the civil service preference, which is ABSOLUTE: the regulation's own worked example ranks a disabled veteran scoring 80 above a non-veteran scoring 90. It is also wartime-defined, which the headline never says. Geography is complete for all counties; county tax rates and the local layer are not.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. New Jersey has 21 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Statutory terms of the National Guard free tuition benefit

    high confidence it exists · N.J.S.A. 18A:62-24

    The benefit itself is published in this corpus from the Department of Military Affairs’ own pages, which state 16 credits a semester at any New Jersey public college or university for undergraduate and graduate study. What those pages do not carry is the statute: they say only that state law mandates it. The Legislature’s statute viewer at lis.njleg.state.nj.us is a frame-based application we could not read this session, so the conditions that sit in the text — completion of initial active duty training, good standing, the state reimbursement mechanism and the continuation of eligibility after a medical discharge — are all unverified.

    Still needed: The text of N.J.S.A. 18A:62-24 from an official New Jersey host, for the initial-training condition, the good-standing test, the interaction with federal education benefits and the post-medical-discharge continuation.

  • Free or reduced vital record copies for a veterans benefit claim

    medium confidence it exists · To be identified (N.J.S.A. 26:8 vital statistics fees)

    A no-fee certified copy of a birth, death or marriage record where it is needed to support a veterans benefit claim exists in several states. New Jersey’s Department of Veterans Affairs benefits index does not mention one, and the vital statistics fee provisions were not opened this session, so this is unchecked rather than absent.

    Still needed: The New Jersey vital statistics fee schedule and the governing statute, for whether a military or veterans waiver exists, which records it covers, and any limit on the number of copies.

  • New Jersey statutes — no reachable host this session

    high confidence it exists · N.J.S.A.

    A research wall worth recording. pub.njleg.gov returned ECONNREFUSED to the fetcher on 23 August 2026, so no N.J.S.A. section could be read at source in this round. That is why the $250 property tax deduction and the Law Against Discrimination protections are published at tier B from agency pages rather than tier A from the statute.

    Still needed: A working host for the New Jersey statutes, starting with the property tax deduction section and the Law Against Discrimination.

  • New Jersey Servicemembers’ Civil Relief Act

    high confidence it exists · Supplement to Title 38A of the New Jersey Statutes

    New Jersey appears to have its own servicemembers’ relief act supplementing Title 38A, covering eviction and lease termination for leases executed before entry into service, and reported to bar a lessor from imposing a penalty or charge on the lessee or a co-signer for early cancellation. None of it was read at source. The Division of Consumer Affairs military page at njconsumeraffairs.gov/dva returned an empty body to the fetcher on both the bare path and the default.aspx path, and the statutes host refused the connection.

    Still needed: The New Jersey Servicemembers’ Civil Relief Act text, or the Division of Consumer Affairs military outreach page from a host that serves content.

  • Utility discounts or a veteran route into energy assistance

    low confidence it exists · To be identified

    Utilities are uncovered for New Jersey. The Department of Veterans Affairs benefits index groups housing and utilities together and points only to charities and nonprofits — Volunteers of America, Community Hope, Catholic Charities — with no state-administered utility route named.

    Still needed: The Board of Public Utilities Lifeline credit and Universal Service Fund pages, checked for any veteran eligibility route, and confirmation of an absence if there is none.

  • The department split, and every URL in this corpus that it broke

    high confidence it exists · Not applicable — access intelligence

    On 9 January 2026 the Department of Military and Veterans Affairs SPLIT INTO TWO departments: a Department of Military Affairs at military.nj.gov and a Department of Veterans Affairs at veterans.nj.gov, which serves from nj.gov/dva/. Confirmed on 23 August 2026 by opening two old pages under nj.gov/military/veterans/ — both now return a transformation notice and a redirect link where the content used to be, dated 23 December 2025. Any record in this corpus still citing nj.gov/military/veterans/ is citing a notice, not a benefit, and the administering entity names may need changing with it.

    Still needed: A sweep of every source URL and entity name in the New Jersey corpus against the new /dva/ tree, and a decision on which records now belong to which of the two departments.

  • Beginning farmer and agricultural programmes with a veteran route

    medium confidence it exists · N.J.S.A. — to be identified

    The veterans department’s benefits and services tree was read in full on 23 August 2026 and names no agricultural programme. Whether the agriculture department runs a veteran route into beginning-farmer support, farmland preservation or agricultural fee concessions is entirely unresearched for this state.

    Still needed: The agriculture department’s beginning farmer pages, read for a veteran-specific route rather than a general one.

  • The eligible offences and the eligible servicemember test in the diversion programme

    high confidence it exists · P.L. 2017, c. 042

    The programme is now PUBLISHED: nj-veterans-diversion-program (23 August 2026), read from the veterans department’s own page. That page is written to recruit volunteer mentors, so it carries the mentor guidelines and the public-law number but not the two tests that decide everything: which offences are eligible, and which servicemembers are. The statute itself was not read this session.

    Still needed: The text of P.L. 2017, c. 042 as codified, for the eligible offence list, the eligible servicemember definition, the programme length and the effect of completion on the charge.

Virginia — 16 on the worklist

Five research passes over Virginia law. The fifth added the disabled veteran plates — free registration on one vehicle, and the gate is ANY service-connected disability with no percentage, the widest vehicle gate in this corpus.

  • National Guard State Tuition Assistance — the per-credit rate and any cap the department applies

    high confidence it exists · Va. Code §23.1-610; Department of Military Affairs programme policy

    The published record carries the statute in full, and the statute sets the award as a difference rather than a rate. What the Department of Military Affairs actually pays per credit in a given year, and whether it applies an internal cap, decides whether the grant covers a semester or a fraction of one.

    Still needed: The Department of Military Affairs’ own tuition assistance programme page and current award schedule at va.ng.mil. Not read 23 Aug 2026; dvs.virginia.gov refused retrieval again this session, which is the department page the corpus would normally cross-check against.

  • Va. Code §44-93.2 — leaves of absence from nongovernmental employment

    high confidence it exists · Va. Code §44-93.2

    The published military leave record covers public employment only. The overwhelming majority of Guard and reserve members in the Commonwealth work in the private sector, and the section that governs them is unread.

    Still needed: The text of Va. Code §44-93.2 on law.lis.virginia.gov, which reads reliably. Simply not reached in this round.

  • Local-option real estate tax deferral — whether any locality writes it for veterans

    medium confidence it exists · Va. Code §§58.1-3219, 58.1-3219.1

    §58.1-3219 lets any county, city or town adopt a deferral programme by ordinance and leaves the terms to the locality. It is not veteran-specific on its face, but a deferral is materially different from an exemption and no record in this corpus covers deferral at all. Whether any Virginia locality writes veteran-specific terms into its ordinance is unknown.

    Still needed: The text of Va. Code §58.1-3219.1 for the interest and repayment conditions, and a sample of local deferral ordinances. Tried 23 Aug 2026: §58.1-3219 read on law.lis.virginia.gov but stops short of the conditions, which it refers to §58.1-3219.1.

  • State veterans cemeteries — locations, fee schedule and eligibility guidelines

    high confidence it exists · Va. Code §2.2-2001 B; Department of Veterans Services eligibility guidelines

    The burial record we publish rests on the Code alone. The Department is required by §2.2-2001 to establish eligibility guidelines for Virginia-domiciled veterans and their spouses, orphans and dependants, and those guidelines — not the statute — are what a cemetery applies. The cemetery locations, the interment application and the fee the Commonwealth is directed to pay are all unread.

    Still needed: The Department’s cemetery pages and its published eligibility guidelines. Tried 22 Aug 2026: dvs.virginia.gov resists both direct retrieval and browser navigation, as previously recorded. A published guidelines document hosted elsewhere on a Commonwealth domain would do just as well. Re-examined 23 Aug 2026 from the Code side: §2.2-2001 was read again in full and contains nothing beyond what is already published — subsection A (offices, care centers and cemeteries), B 1 (vaults at cost), B 2 (the burial fee) and C (eligibility guidelines). The Amelia, Suffolk and Dublin locations, the spouse and dependant fee schedule, the residency test and any pre-registration route are on the blocked host and nowhere in the Code.

  • Locality burial allowance or indigent veteran burial duty, headstone setting, grave registration by the clerk

    low confidence it exists · Title 15.2 (Counties, Cities and Towns); Va. Code §32.1-309.2; Title 57 ch. 3

    Several states place a burial allowance, an indigent veteran burial duty, a headstone-setting reimbursement or a grave registration duty on the locality or on the circuit court clerk. Searched for a Virginia equivalent on 23 Aug 2026 and did not find one. What was found is not veteran-specific: §15.2-978 is registration by a locality of cemeteries on private property, §15.2-1812 is authority to erect and to remove war memorials, §57-35.36 concerns cemeteries owned by localities, and §32.1-309.2 places the expense of disposing of an unclaimed dead body on the county or city of residence for anyone, veteran or not. The confidence is low because the searching, not the reading, is what came up empty.

    Still needed: A section-level read of Title 15.2 chapters 11 and 12 and of Title 57 chapter 3 looking specifically for a veteran clause, rather than the keyword searching done this session. Tried 23 Aug 2026 via law.lis.virginia.gov search across Title 15.2 chapter 9, Title 57 chapter 3 and Title 32.1 chapter 8.1: readable throughout, simply silent on a veteran-specific locality burial duty.

  • Whether a court may weigh past or future deployment in a best-interests determination

    medium confidence it exists · Va. Code §20-124.3 (best interests of the child; factors)

    The published custody record covers §§20-124.7 through 20-124.10, all four read in full on 23 Aug 2026. None of them prohibits a court from treating a parent’s past or possible future deployment as a factor. Several states carry that prohibition inside their best-interests statute rather than inside their military parents act, which is where it would sit here if it exists. It is the single most-asked question a deploying parent has and the corpus cannot answer it.

    Still needed: The text of Va. Code §20-124.3 on law.lis.virginia.gov, which reads reliably. Not reached this session — the chapter 6.2 sections were read instead.

  • How VA disability compensation is counted in the Energy Assistance gross monthly income test

    high confidence it exists · Virginia Department of Social Services Energy Assistance Manual

    The published utilities record establishes that no veteran preference exists and that the gate is 150 percent of the federal poverty level. Whether VA disability compensation is counted toward that gross monthly income figure decides eligibility for a large share of disabled veteran households, and it is the one question the programme page does not answer.

    Still needed: The countable-income chapter of the Energy Assistance Manual at https://www.dss.virginia.gov/files/division/bp/ea/intro_page/manual/Complete_Manual.pdf — surfaced in search on 23 Aug 2026 but not retrieved or read. The programme page at https://www.dss.virginia.gov/relief/ea/ reads fine and was read, but is silent on income sources.

  • Veteran or hardship programmes at utilities other than the dominant electric provider

    low confidence it exists · SCC-approved tariffs; co-operative and municipal utility policy

    The absence record rests on one investor-owned utility’s residential tariff index, read 23 Aug 2026. Virginia also has electric co-operatives, municipal utilities, a second investor-owned electric utility, and gas, water and telephone providers. A hardship fund run outside a filed tariff would not appear in what was read, and co-operatives in particular run member assistance funds that are not tariffs at all.

    Still needed: Tariff or programme pages for the other Virginia utilities. Tried 23 Aug 2026: search across scc.virginia.gov returned rate-case news releases and docket PDFs rather than a tariff index, and https://www.dominionenergy.com/virginia/rates-and-tariffs/residential-rates read fine but covers one utility only.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Virginia has 133 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Virginia state veterans care centers (skilled nursing)

    high confidence it exists · Va. Code title 2.2 ch. 20.1 (Department of Veterans Services)

    The department runs state veterans care centers including the Sitter & Barfoot Veterans Care Center in Richmond, with published admission criteria (honorable discharge, Virginia residency at admission or entry into active duty from Virginia, and for post-1980 enlistees a 24-continuous-month service test) and a published daily rate where the VA per diem facility credit is not approved. None of that is publishable because the department's own site would not serve us.

    Still needed: A readable copy of the department's veteran skilled nursing pages. Tried 22 Aug 2026 and all refused: https://www.dvs.virginia.gov/healthcare/veteran-skilled-nursing-facilities-state-veterans-homes (WebFetch HTTP 403), https://www.dvs.virginia.gov/healthcare/veteran-skilled-nursing-facilities-state-veterans-homes/richmond-sitter-barfoot-veterans-care-center (WebFetch HTTP 403), and the same host in a browser tab returned an "Access Denied" page. The department's published PDF at https://www.dvs.virginia.gov/home/showpublisheddocument/872/638979380207530000 sits on the same blocked host.

  • Veterans department eligibility certificate for service-disabled veteran business status

    high confidence it exists · Va. Code §2.2-2001 et seq.; 7 VAC 13-20

    The small business certifier states that the veterans department issues the eligibility certificate that creates service-disabled veteran status in the vendor database, and gives a phone number for it. The certificate's own criteria — minimum rating, ownership share, documentation — are on the veterans department page we could not read.

    Still needed: The page at https://www.dvs.virginia.gov/benefits-services/service-disabled-owned-business-designation, which returned WebFetch HTTP 403 on 22 Aug 2026 (same host-level block as the care centre pages).

  • How the discharge reclassification petition actually works

    high confidence it exists · Va. Code § 2.2-2001.6; Department of Veterans Services procedure

    The statute creates the petition and states its whole effect but names no form, no evidentiary standard, no decision-maker within the Department, no processing time and no appeal. A veteran with an other than honorable discharge given for sexual orientation or gender identity has a right they cannot exercise without knowing the procedure.

    Still needed: The Virginia Department of Veterans Services own page on the petition. Tried 23 Aug 2026: dvs.virginia.gov has refused retrieval in this and every prior session. A Virginia Attorney General opinion, a Department annual report under § 2.2-2001, or a Virginia legal aid guide published by a state body is the way in.

  • Which Virginia localities operate a veterans docket

    high confidence it exists · Va. Code § 2.2-2001.1(C)

    Subsection C makes the establishment of special treatment procedures for veterans a matter for each locality. Which localities have done so, and what their eligibility gates and completion outcomes are, is the operative fact for anyone facing a charge, and the corpus cannot supply it.

    Still needed: The Supreme Court of Virginia specialty dockets pages, or the Department of Veterans Services annual report under § 2.2-2001.1(D). Tried 23 Aug 2026: dvs.virginia.gov refused retrieval; law.lis.virginia.gov was read successfully for the statutory text but publishes no docket list. vacourts.gov was not reached this session and is the next thing to try.

  • Toll exemption window sticker — the application, the processing time and which operators honour it

    high confidence it exists · Va. Code § 33.2-613(D)(3); Virginia Department of Transportation programme guidance

    The statute makes a Department of Transportation window sticker a condition of free passage and was read in full this session, but it names no form, no processing time and no renewal cycle. It also leaves open whether the Public-Private Transportation Act operators who run most of the busy Hampton Roads and Northern Virginia crossings honour the sticker in practice, since subsection F narrows those facilities as against subsections A, B and C only.

    Still needed: The Virginia Department of Transportation page or form for the disability toll-exemption window sticker, and any operator-level statement from the Elizabeth River Crossings, the Express Lanes or the Chesapeake Bay Bridge-Tunnel. Tried 23 Aug 2026: law.lis.virginia.gov read cleanly for § 33.2-613 itself; no VDOT sticker page was located.

  • Gold Star plate — which relatives qualify, and whether remarriage ends it

    high confidence it exists · Virginia DMV form VSA 10A, Gold Star or Next of Kin License Plate Applicant Certification

    The published record establishes that the plate exists, costs $0 a year and is not in the Code of Virginia at all — Article 10 of Title 46.2 was retrieved in full and searched. What it cannot establish is who counts as an eligible family member, or whether a widow who remarries keeps the plate, because the Department states neither on its plate page.

    Still needed: The printed eligibility text of form VSA 10A. Tried 23 Aug 2026: the form PDF at https://www.dmv.virginia.gov/sites/default/files/forms/vsa10a.pdf was retrieved but its body text is outlined artwork and only field labels could be extracted; the plate page at https://www.dmv.virginia.gov/vehicles/license-plates/search/gold-star reads and states the fee and the form number but no eligibility list.

  • Whether Virginia funds any caregiver stipend, respite or adult day health route for veteran households

    medium confidence it exists · Va. Code § 2.2-2001.1; Department for Aging and Rehabilitative Services programmes

    Chapter 20 of Title 2.2, the Department of Veterans Services chapter, was listed and its sections read this session — §§ 2.2-2000 through 2.2-2004.3 — and none of them mentions a caregiver, respite or adult day health programme. The ageing of the veteran population makes this worth settling either way rather than leaving unexamined.

    Still needed: The Department for Aging and Rehabilitative Services caregiver pages and any Virginia Veteran and Family Support Program material on caregivers. Tried 23 Aug 2026: law.lis.virginia.gov read cleanly for the whole of Title 2.2 Chapter 20 and no caregiver provision exists in it; dvs.virginia.gov refused retrieval again.

Washington — 14 on the worklist

Five research passes over Washington law. The fifth added the DAV plates: no licence fees, plate fees or excise taxes on one vehicle, behind one of the narrowest gates here — and the money can be taken on regular plates.

  • National Guard grant — the rules for being relieved of the service obligation

    high confidence it exists · RCW 28B.103.010; rules adopted by the Washington Student Achievement Council

    The statute makes the grant conditional on one year of Guard service for each year funded, and lets a participant be relieved of that obligation under rules the office adopts. Those rules decide what happens to a member who is separated for medical reasons mid-programme, which is the question worth answering before accepting the money.

    Still needed: The council’s adopted rules on relief from the National Guard grant service obligation, in the Washington Administrative Code. Not reached 23 Aug 2026.

  • Veterans Innovations Program — the maximum award

    high confidence it exists · Washington State Department of Veterans Affairs programme policy

    The published record establishes eligibility and what the money can be spent on, but the department publishes no maximum grant. A veteran facing a $4,000 arrears figure needs to know whether this programme can reach it before building a plan around it.

    Still needed: The department’s VIP application form and any published award ceiling. Tried 23 Aug 2026: the programme page at https://dva.wa.gov/node/1383/veterans-innovations-program-vip reads but states no maximum; the linked application PDF at https://dva.wa.gov/sites/default/files/2020-02/VIP%20Application%20for%20Website.pdf was not retrieved as text.

  • Counseling programme — the county-by-county military service requirement

    medium confidence it exists · Washington State Department of Veterans Affairs programme policy

    The department states plainly that eligibility applies regardless of discharge status but that the military service requirement varies by county. No county-level table is published, so a veteran cannot tell in advance whether their service length qualifies where they live.

    Still needed: The department’s counsellor directory with its per-county service conditions, at https://www.dva.wa.gov/program/counselors. Not read 23 Aug 2026.

  • Low-income utility discount — what the discount actually is at each regulated company

    high confidence it exists · RCW 80.28.068; each company’s approved tariff schedule; RCW 19.405.020 for the income definition

    RCW 80.28.068 was read this session and it names veterans’ benefits among the public benefits that verify eligibility, but it fixes no discount figure and carries the definition of "low-income" by cross-reference. A veteran can be told the programme exists and cannot be told what their bill would fall to, or whether their income clears the line.

    Still needed: The approved tariff percentages for the Puget Sound Energy, Avista, Pacific Power, Cascade Natural Gas and NW Natural low-income discount rates, plus RCW 19.405.020. Tried 23 Aug 2026: https://www.utc.wa.gov/consumers/energy/energy-assistance-programs reads but names the programmes without discount figures and names no veteran route; RCW 19.405.020 not fetched.

  • City-owned utilities and public utility districts — the assistance this statute does not reach

    medium confidence it exists · Local ordinance; public utility district resolution; Title 35 and Title 54 RCW

    RCW 80.28.068 binds companies regulated by the utilities and transportation commission. Seattle City Light, Tacoma Power, Snohomish County PUD and the other consumer-owned utilities sit outside it and set their own assistance rules, so a large share of Washington households are not covered by the record published this session.

    Still needed: The published low-income or senior discount rules of the largest consumer-owned utilities, and whether any names a veteran route. Not attempted 23 Aug 2026.

  • County burial allowance — the ceiling each county legislative authority has established

    high confidence it exists · RCW 73.08.070; county legislative authority resolutions

    RCW 73.08.070 was read this session and sets a floor of $300 with the ceiling delegated to each county legislative authority. Thirty-nine counties can hold thirty-nine different figures, and the figure above the floor is the one a grieving family actually needs.

    Still needed: Published resolutions or veterans’ assistance fund policies setting the disposition-of-remains ceiling, starting with King, Pierce, Snohomish and Spokane. No statewide table was found 23 Aug 2026 and the statute requires none.

  • Military funeral honours and any state stipend for providing them

    medium confidence it exists · Unknown — no section of chapter 73.08 RCW or chapter 73.24 RCW provides for it

    Chapter 73.08 RCW was listed in full this session and contains six sections, none of which funds funeral honours or the setting of a headstone. Chapter 73.24 RCW covers only the veterans’ plot at Olympia. If Washington funds an honours detail or a marker-setting allowance, the authority sits somewhere not yet found.

    Still needed: The Washington Military Department or veterans affairs department page on military funeral honours, and any RCW authorising a stipend. Tried 23 Aug 2026: https://app.leg.wa.gov/RCW/default.aspx?cite=73.08 and https://app.leg.wa.gov/RCW/default.aspx?cite=73.24 both read and neither contains such a provision.

  • Veterans’ plot at Olympia — burial without charge, and who is still eligible

    medium confidence it exists · RCW 73.24.020; RCW 73.24.030; RCW 41.04.007

    RCW 73.24.030 was read in summary this session: the plot is available without charge or cost to the extent space is available, to those who served in named conflicts between 1898 and 1902 and, on the wording returned, to a person qualifying as a veteran under RCW 41.04.007 — a definition that would reach far beyond that era. The two readings differ enormously in who they cover and the section was not read line by line.

    Still needed: The verbatim text of RCW 73.24.020 and RCW 73.24.030, RCW 41.04.007, and whether space in fact remains. Tried 23 Aug 2026: https://app.leg.wa.gov/RCW/default.aspx?cite=73.24.030 returned a summary that did not settle the eligibility question.

  • State veterans cemetery — the residency test and pre-eligibility determination

    high confidence it exists · Washington State Department of Veterans Affairs cemetery policy; 38 CFR part 39 for the state cemetery grants programme

    The published cemetery record carries the charges. What it does not carry is the residency test that decides who may be interred at Medical Lake, or whether a veteran can obtain a pre-eligibility determination in advance so the family is not settling it at the funeral.

    Still needed: The department’s cemetery eligibility and pre-registration pages beyond https://dva.wa.gov/veterans-service-members-and-their-families/cemetery, which was already the source for the charges. Not reached 23 Aug 2026.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Washington has 39 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Which Washington counties actually have a state-funded veterans service officer

    high confidence it exists · RCW 43.60A.230; RCW 43.60A.235; RCW 43.60A.237

    The statute makes counties of one hundred thousand people or less eligible and funds them first come, first served, one full-time officer each. Being eligible is not being funded, and a veteran in a small county has no way to know which they are in. The department is required to educate local governments and veterans about the programme, so a list ought to exist.

    Still needed: The Washington State Department of Veterans Affairs own veterans service officer programme page, or its report to the legislature. Tried 23 Aug 2026: app.leg.wa.gov was read successfully for both versions of RCW 43.60A.230 and for RCW 43.60A.237, but publishes no county list; dva.wa.gov was read for the women veterans page and was not searched for the service officer programme page, which is the next thing to try.

  • Veteran Directed Care and caregiver support — eligibility, the service budget, and whether a family member can be hired

    high confidence it exists · Washington State Department of Veterans Affairs caregiver programme; Home and Community Living Administration, Veteran Directed Care

    Veteran Directed Care is the one programme in this state that lets a veteran manage a care budget directly, and the question a family actually asks — can I be paid to care for him — is exactly the question the published pages do not answer. Chapter 43.60A RCW, the veterans affairs chapter, was retrieved in full this session and contains no caregiver, respite, adult day or in-home provision at all, so the programme is administrative rather than statutory.

    Still needed: The Veteran Directed Care participant handbook and policy manual, and the Department of Veterans Affairs caregiver page. Tried 23 Aug 2026: https://www.dshs.wa.gov/altsa/stakeholders/veteran-directed-care-vdc reads but is a navigation hub with no eligibility, budget or family-hiring detail; https://www.dva.wa.gov/i-am-caregiver returned 403 both by fetch and by direct request with a browser user agent.

  • Gold star plate — how the Department of Veterans Affairs certifies an eligible family member

    high confidence it exists · RCW 46.18.245(1)(c); Washington State Department of Veterans Affairs certification procedure

    RCW 46.18.245 was read in full and makes departmental certification a condition of the plate, but the department publishes no procedure that was reachable this session. A bereaved sibling or stepparent — both named in the statute — has no way to know what evidence to bring.

    Still needed: The department certification form or procedure for gold star plate eligibility. Tried 23 Aug 2026: app.leg.wa.gov read cleanly for RCW 46.18.245; dva.wa.gov returned 403.

  • Whether the Transportation Commission fare rules carry any veteran provision the fare pages do not mention

    medium confidence it exists · RCW 47.60.315; Washington Administrative Code chapter 468-300

    RCW 47.60.315 was read in full this session and delegates fares entirely to rule, so the absence established on the ferry pages is an absence in the published fare summaries rather than in the rules themselves. The chief executive officer also has a standing power to authorise promotional and special event fares, which is where a veteran fare would sit if one were ever created.

    Still needed: The Transportation Commission ferry fare rules in the Washington Administrative Code, and any promotional fare authorisations. Tried 23 Aug 2026: app.leg.wa.gov read cleanly for RCW 47.60.315; the WAC chapter was not fetched.

Arizona — 11 on the worklist

Four research passes over Arizona law. The fourth added the employment preference (five points, ten disabled, capped at ten — and the disabled tier is an impairment test, not a VA percentage) and the §28-5802 vehicle exemption: no licence tax or registration fee on one vehicle at 100%, surviving to the spouse.

  • State Tuition Reimbursement — the current per-semester and per-fiscal-year caps

    high confidence it exists · A.R.S. §26-179; DEMA Directive 40.4

    A.R.S. §26-179 sets no dollar figure and leaves allocation to the adjutant general. The published record therefore carries no cap, and the cap is the first thing a guardsman needs before enrolling.

    Still needed: The department’s State Tuition Reimbursement information sheet and current application. Tried 23 Aug 2026: https://dema.az.gov/sites/default/files/2023-08/State-Tuition-Reimbursement_Information_Sheet.pdf returned HTTP 403, and https://dema.az.gov/education was not reached. DEMA Directive 40.4 at https://dema.az.gov/sites/default/files/2022-10/40.4_State_Education_Reimbursement19950801.pdf is a second way in.

  • Department of Veterans’ Services programme pages — behavioural health, Be Connected, and the rest

    high confidence it exists · Arizona Department of Veterans’ Services published programmes

    Arizona runs a nationally recognised veteran suicide prevention effort in Be Connected, coordinated with the department, and the corpus carries nothing on behavioural health for this state. The department’s programme index would also settle what else is unrecorded.

    Still needed: Any page on dvs.az.gov. Tried 23 Aug 2026: https://dvs.az.gov/, https://dvs.az.gov/programs-services and https://dvs.az.gov/be-connected all returned HTTP 403 to direct retrieval — the host refused every attempt this session, having read in earlier ones. Retry direct retrieval in a later session before falling back to a browser.

  • Military Family Relief Fund — the statute behind the programme

    high confidence it exists · A.R.S. §41-608.04

    The relief fund record we publish rests entirely on the department’s own programme page. The statute is cited by the department but was not read, so how the fund is capitalised, what happens when it is exhausted, whether the $20,000 lifetime limit is statutory or administrative, and what constraints bind the advisory committees are all unverified.

    Still needed: The text of A.R.S. §41-608.04. The department links it from https://dvs.az.gov/services/financial-assistance/military-family-relief-fund but the link was not followed this session; note that dvs.az.gov sits behind a bot-protection interstitial that refuses direct retrieval and clears only in a browser.

  • Recreation — the operational side, and state park concessions

    high confidence it exists · A.R.S. §17-333; state parks authority to be identified

    The licence statute itself is now read and published (22 August 2026): complimentary at 100% permanent, half price for Purple Heart recipients, and a discretionary "up to twenty-five percent less" tier for any compensated service-connected disability. What remains unread is the operational layer — the game and fish department (azgfd.com) sits behind a Cloudflare wall, so the application forms, the licence classes issued under commission rule, and the actual discount set inside the 25% ceiling are unverified. State park admission concessions, if any, are a separate agency and wholly unresearched.

    Still needed: A readable game and fish department page for the forms, licence classes and the set discount inside the statutory ceiling; the state parks agency page for any admission concession.

  • State veterans cemeteries — the spouse and dependent fee amounts

    high confidence it exists · A.R.S. §41-603(C)

    The core record is now PUBLISHED (az-state-veterans-cemeteries, 22 August 2026): a rendered browser session got past the dvs.az.gov interstitial that had 403'd every non-browser tool the same day, and the department's cemeteries page yielded the three sites, the no-cost inclusions, the assignment-at-need rule, family eligibility and the pre-registration route. What the page does NOT publish is a fee schedule — it links to 'Pay Interment Fees Online', so a fee exists for some interments (spouse and dependent, per unreadable search shells), but no amount is stated anywhere we have read.

    Still needed: The interment fee schedule itself — the spouse/dependent amounts and which interments they attach to — from the department's fee page or the cemetery brochures.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Arizona has 15 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Arizona State Veteran Homes — residency test and what a resident pays

    high confidence it exists · A.R.S. title 41 ch. 3 art. 2 (Department of Veterans’ Services)

    The four homes are published with their admission eligibility, but no Arizona residency duration is stated and no private-pay daily rate, VA per diem treatment or state Medicaid position appears on the department pages. Search results referred to a "Private Pay Daily Rate" in the homes’ information packets.

    Still needed: The homes’ information packets and application packet. Tried 22 Aug 2026: https://dvs.az.gov/services/arizona-state-veteran-homes and the Phoenix home page were readable only through a browser tab (WebFetch returned HTTP 403 and the host runs an interstitial challenge), and the linked PDFs at https://dvs.az.gov/sites/default/files/2023-08/Arizona_State_Veteran_Homes_Application_Aug_2023.pdf and the per-home informational packets were not read.

  • State certification or procurement preference for veteran-owned businesses

    low confidence it exists · Unknown — no A.R.S. citation identified

    SHARPENED 23 Aug 2026 and the picture is now much clearer, but still short of publishable. The idea exists in Arizona only as BILL text, not as statute. HB2475 (51st Legislature, 2nd Regular Session) would have added a veteran-owned business participation goal to title 41, chapter 23, article 3 — a goal of at least one and one-half per cent in the first year rising to three per cent thereafter, met using a registry of certified veteran-owned businesses compiled by the director of the department of veterans’ services, with "veteran" defined as separated under honorable conditions after more than six months of active duty. We could find no enacted A.R.S. section carrying it. The whole title 41 section index was read this session and NOT ONE of the veteran-titled sections (41-601 through 41-612) is about business or procurement, and the procurement code sections that came back on search (41-2501, 41-2532, 41-2636, 41-2637, 41-2752) are about applicability, source selection, nonprofit agencies serving individuals with disabilities and correctional industries, procurement exemptions and competition with private enterprise — none of them veteran-related. Working hypothesis is now that the bill died and Arizona runs no state-level veteran-owned business preference.

    Still needed: Two things, either of which closes this. (1) Confirmation the bill was never enacted — track HB2475 at https://www.azleg.gov/legtext/51leg/2r/bills/hb2475p.htm through its session history. (2) A readable state administration department procurement page or veterans department services index stating in terms that no veteran-owned business certification or preference exists, which would let us publish this as an ABSENCE record on the dc-military-retirement-fully-taxable model. Tried 23 Aug 2026: https://www.azleg.gov/ars/41/02560.htm returned HTTP 404 (the section number suggested by search does not exist), and dvs.az.gov continues to refuse direct retrieval.

  • Utilities — any Arizona Corporation Commission-approved veteran discount, or a proven absence

    medium confidence it exists · A.A.C. R14-2-xxx; ACC-approved utility tariffs

    The corpus holds only two utilities records in total and Arizona has none, so either a real veteran route or a clean proven absence is worth having. The commission regulates the electric, water and gas utilities and every major one runs a low-income assistance programme, but whether any of them carries a VETERAN eligibility route — as opposed to a purely income-based one — is exactly the question we could not answer from a source we are willing to cite. Search shells referred to federal assistance programme participation (including veterans’ assistance) as a qualifying route into telephone lifeline-style discounts, and to state programmes (LIHEAP, and a state-funded expansion) that are income-tested rather than veteran-tested — but a search shell is a lead, not a source, and none of it was read on the commission’s own page.

    Still needed: Any readable page on azcc.gov. Tried 23 Aug 2026: https://azcc.gov/utilities/financial-assistance-programs, https://www.azcc.gov/utilities/financial-assistance-programs and https://www.azcc.gov/faqs/utilities-faqs ALL failed at the network layer with ECONNREFUSED to 159.87.121.149:443 — this is a refused connection rather than a bot-protection interstitial, so a browser session may not help either and the host may simply be unreachable from here. Retry direct retrieval in a later session. Failing that, the tariff sheets for the large regulated utilities, or the commission’s eDocket at https://edocket.azcc.gov/, are the second way in. If the commission’s own page turns out to describe only income-tested programmes with no veteran route, publish that as an ABSENCE record rather than leaving the category empty.

  • Residential lease termination for servicemembers — is there really no general-act right?

    medium confidence it exists · A.R.S. title 33 ch. 10 (Arizona Residential Landlord and Tenant Act)

    PARTIALLY SETTLED 23 Aug 2026 and now published as a correction on az-33-1413-mobile-home-military-termination. The short-notice termination on reassignment orders was found in A.R.S. §33-1413(F), which is the MOBILE HOME PARK act. We then read both early-termination sections of the general residential act to test whether an equivalent exists there: §33-1318 is written for domestic violence and sexual assault and contains no military provision, and §33-1318.01 is an early release termination for law enforcement officers only. So an ordinary apartment tenant in this state appears to have no state statute and to be relying on federal law. What is NOT yet proven is that no such right sits somewhere else in the act under a heading we did not think to check.

    Still needed: A section-by-section read of the general provisions of A.R.S. title 33 chapter 10 (roughly §33-1310 to §33-1319) and of the remedies article (§33-1361 to §33-1379) looking for any military, armed forces, deployment or permanent change of station provision. The chapter index at https://www.azleg.gov/arsDetail/?title=33 reads fine and returned only the section titles this session, not their text. If the absence holds, upgrade the correction note on the published record from "we read both early-termination sections" to a proven negative across the chapter.

  • Whether Arizona has a statutory basis for veteran courts, and whether the 2026 veterans court fund bill became law

    high confidence it exists · A.R.S. title 11 or title 13; 57th Legislature 2nd Regular Session HB2960 (veterans court fund; grant program) and SB1275 (veterans diversion program)

    Eleven veteran courts are listed by the department, but no Arizona statute establishing them was found — titles 11, 12, 13 and 41 were each listed and searched. Two 2026 bills would change that: one creating a veterans court fund and grant programme, one authorising a county attorney to establish a veterans diversion programme for a defendant who is a military member or veteran. Whether either was enacted is the difference between a discretionary programme and a funded statutory one.

    Still needed: The enacted-laws pages for the 57th Legislature, 2nd Regular Session. Tried 23 Aug 2026: https://www.azleg.gov/arsDetail/?title=11, ?title=12, ?title=13 and ?title=41 were each read and contain no veteran court section; https://www.azleg.gov/ars/11/00365.htm was read and § 11-365 contains no veteran provision. The bill texts at https://www.azleg.gov/legtext/57leg/2R/bills/HB2960H.pdf and .../SB1275H.pdf are engrossed versions, not session laws; the session laws index at azleg.gov/legtext/57leg/2R/laws/ is the way in.

Tennessee — 12 on the worklist

Five research passes over Tennessee law. The fifth added the free DV plate and registration at 100% permanent total or the functional tests, with the unusual half-fee second plate.

  • Tenn. Code §5-8-102 — the county motor vehicle privilege tax exemption

    high confidence it exists · Tenn. Code §5-8-102(a), (d)

    The published record rests on the veterans department’s summary. The statute is where the documentary standard, the number of vehicles covered per veteran, and whether a surviving spouse retains the exemption are set — and none of that is verified.

    Still needed: The text of Tenn. Code §5-8-102. No official Tennessee host served the Code to us on 23 Aug 2026; the Tennessee Code is published commercially rather than on tn.gov. An official mirror is the way in.

  • STRONG Act — Public Chapter No. 216 and the conflicting submission windows

    high confidence it exists · Public Chapter No. 216 (Tennessee STRONG Act)

    Two Tennessee agencies publish different reimbursement submission deadlines for the same programme — 45 days from the last class on the military department’s page, 90 days from course completion on the veterans department’s. They also frame the credit-hour ceiling differently. The statute would settle both, and it would also say whether the pilot has an end date.

    Still needed: The text of Public Chapter No. 216 and the programme’s administrative rules. Tried 23 Aug 2026: both agency pages read on tn.gov but neither reproduces the chapter; the chapter text was not located on an official host.

  • Go-DBE certification for service-disabled veteran-owned businesses

    high confidence it exists · Tenn. Code §§12-3-1101 to 12-3-1113, especially §12-3-1102

    Tennessee has no business or procurement record in this corpus. The Governor’s Office of Diversity Business Enterprise certifies service-disabled veteran-owned businesses at a 20 percent service-connected disability threshold and 51 percent ownership, and certified firms can petition for exemption from protest bond requirements below $1,000,000 — none of it verified.

    Still needed: The Go-DBE certification overview and programme eligibility pages. Tried 23 Aug 2026 twice, in two separate sessions: https://www.tn.gov/generalservices/procurement/central-procurement-office--cpo-/governor-s-office-of-diversity-business-enterprise--godbe--/godbe-certification-overview.html, its program-eligibility.html sibling and the /go-dbe/ variant all returned HTTP 404 to direct retrieval, though other tn.gov pages read normally in the same session — including deep tn.gov/veteran and tn.gov/tpuc pages. The pages are still indexed and appear in search results, so they exist but will not serve us. The official state mirror at www.firesafekids.state.tn.us/generalservices/procurement/central-procurement-office--cpo-/go-dbe.html fails TLS: the certificate covers only tn.gov, www.tn.gov, tennessee.gov and www.tennessee.gov. NEXT ROUTE: the Diversity Utilization Plan PDF under tn.gov/content/dam/tn/generalservices/documents/cpo/, which is a dam-hosted asset of the kind that has served us reliably elsewhere on tn.gov, or the electronic certification system at tn.diversitysoftware.com. Business and procurement remains a zero-record category for Tennessee.

  • A county burial allowance or headstone-setting allowance for an indigent veteran

    low confidence it exists · Tenn. Code §5-9-101(4); §5-9-311

    Several states carry a statutory county duty to bury an indigent veteran with a named dollar allowance and a separate marker-setting allowance. We went looking for Tennessee’s and did not find one. What Tennessee appears to have instead is a general county power to appropriate funds for the burial or cremation of any indigent person, with no veteran-specific allowance and no statutory figure — and the veteran-specific route the state actually publishes is the Unclaimed Veteran Remains procedure, now a published record, which routes the veteran to a state veterans cemetery rather than paying a county allowance.

    Still needed: Either the text of Tenn. Code §5-9-101(4) or §5-9-311, or a county trustee or county commission page describing a veteran-specific burial allowance. Tried 23 Aug 2026: no official Tennessee host served us the Code (capitol.tn.gov refuses connections; publications.tnsosfiles.com returns HTTP 403); the Department of Veterans Services’ own burial benefits index at https://www.tn.gov/veteran/veteran-benefits/tn-state-benefits/veteran-burial-benefits.html names no county allowance, no grave registration duty and no funeral-honours stipend among its eight burial items. If the answer is genuinely that Tennessee has none, that is an absence record worth publishing — but it needs the statute read before it can be asserted.

  • The Treasury’s own Military Medal Protection Program page — claim process, search tool and time limits

    high confidence it exists · Tennessee Uniform Unclaimed Property Act (military medal provisions)

    The published record tn-military-medal-protection-program rests entirely on the Department of Veterans Services’ two-sentence summary. The administering agency is the Treasury, and everything operational — how to search, what evidence an heir must produce, whether any fee applies, whether there is any time limit, and which custodian holds a given medal — sits on the Treasury page we could not read.

    Still needed: https://treasury.tn.gov/UCPmedals, or the ClaimItTN.gov search. Tried 23 Aug 2026 four times across three paths — /UCPmedals, /Unclaimed-Property/Military-Medals and a Press Room archive article — and every attempt failed with a connection reset (ECONNRESET). The host would not complete a TLS session for us at all, while tn.gov and thda.org read normally in the same session. Retry treasury.tn.gov directly; it is a different host from tn.gov and may simply have been down.

  • Tennessee lease termination, contract cancellation and interest-rate protections beyond the federal SCRA

    medium confidence it exists · Tenn. Code §66-28-512 (URLTA); §47-18-3xx (health clubs); §26-2-111 (exempt property)

    The corpus has never covered consumer and legal protections for any state. Tennessee is reported to carry residential lease-termination, health-club and satellite-contract, and garnishment-exemption provisions of its own that sit alongside the federal Servicemembers Civil Relief Act. If any of them beat the federal floor — a shorter notice period, a lower penalty cap, a reach to the spouse — that is the record worth having.

    Still needed: The text of Tenn. Code §66-28-512, §26-2-111 or the health-club cancellation sections, or a Tennessee agency page describing a state-law protection. Tried 23 Aug 2026 and this is the wall: the Tennessee Code is not served by any official Tennessee host we can reach. www.capitol.tn.gov and capitol.tn.gov both refuse the connection outright (ECONNREFUSED on 170.142.7.20 and .21) for both /Bills/ and /bills/ paths; publications.tnsosfiles.com returns HTTP 403 for public chapter PDFs; www.tncourts.gov serves a bot-validation interstitial instead of the document. The one official Tennessee publication we DID read on this subject is the Attorney General’s own "Consumer Protection Guide for Consumer Affairs Counselors and United States Military Servicemembers" at https://www.tn.gov/content/dam/tn/attorneygeneral/documents/consumer/militaryguide/militaryconsumerguide.pdf — and its findings are negative: its Residential Lease Termination, Auto Lease Termination, Cell Phone Contracts, interest-rate-cap and Default Judgment sections describe the FEDERAL SCRA only, and its Tennessee Consumer Protection Act chapter cites §§47-18-101, -109, -110, -111 and -120 without a single military-specific provision. It is also stale — it states the law is current only through April 2014. So either the state-law layer does not exist, or the AG did not think it worth telling servicemembers about. Settle it against the Code itself when a route to the Code opens.

  • Uniform Deployed Parents Custody and Visitation Act, and the bar on permanent custody modification for a mobilized parent

    high confidence it exists · Tenn. Code §§36-7-101 to 36-7-503; Tenn. Code §36-6-113(b), (e)

    This is the strongest consumer-and-legal protection Tennessee appears to carry for a service member, and the corpus has nothing like it for any state. A court is reported to be barred from permanently modifying a custody or visitation decree solely because a parent is mobilized or deployed out of state or out of country, with expedited proceedings, temporary custody orders and delegation of parenting time under the uniform act — and a reported exception where repeated deployments make the primary residential parent unavailable long term.

    Still needed: The text of Tenn. Code §36-6-113 or the §36-7 uniform act, or an official Tennessee courts publication describing them. Tried 23 Aug 2026: https://www.tncourts.gov/sites/default/files/docs/Custody%20and%20Visitation%20Benchcard.pdf returns a browser-validation interstitial rather than the PDF; capitol.tn.gov refuses connections; publications.tnsosfiles.com returns 403. Retry the tncourts.gov benchcard and the Administrative Office of the Courts parenting plan forms, which would cite the section on their face.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Tennessee has 95 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • State recognition or preference for veteran-owned businesses

    medium confidence it exists · Tenn. Code Ann. §12-3-1102 (procurement definitions)

    The procurement definitions section is reported to define a service-disabled veteran-owned business as a for-profit business located in this state, at least 51% owned and controlled by one or more service-disabled veterans (or 50% where solely owned by a service-disabled veteran and spouse), with a service-disabled veteran defined as having at least a 20% service-connected disability. What that definition unlocks — a certification, a goal, a set-aside — is unverified.

    Still needed: The statute text and a state procurement page describing what the definition does. Tried 22 Aug 2026: https://www.tn.gov/veteran/veteran-employment/business-resources.html reads as an entrepreneurship resource page and names only federal surplus property access for federally certified veteran-owned small businesses; it states no state certification, preference or licence fee waiver. The official Tennessee code sits behind a commercial platform we do not treat as a source. Retried 22 Aug 2026 against the certifying body itself, the Governor’s Office of Diversity Business Enterprise: https://www.tn.gov/generalservices/procurement/central-procurement-office--cpo-/governor-s-office-of-diversity-business-enterprise--godbe--/program-eligibility.html, .../godbe-certification-overview.html, .../Go-DBE/program-eligibility.html and .../go-dbe.html all return 404 to direct retrieval and in a browser, and the parent procurement page at .../central-procurement-office--cpo-.html carries no surviving link to the office. The site appears to have been reorganised. NEXT: find the office’s current landing page from the Department of General Services index, or the state’s diversity utilisation plan, which is reported to define a Tennessee service-disabled veteran-owned business as at least 51% owned and controlled by veterans with at least a 20% service-connected disability, certified for a three-year term.

  • Waiver of an initial licensure fee for military applicants

    medium confidence it exists · Tenn. Code Ann. §62-76-105 (fee waiver); §62-76-106 (equivalent credit)

    A waiver of an initial licensure fee is reported to be available on written request on a form prescribed by the commissioner, made at the time of the initial application, and a separate section is reported to give equivalent credit toward an occupational licence for armed forces members and honorably discharged veterans.

    Still needed: Either section read on an official source, or a regulatory boards page stating the waiver. Tried 22 Aug 2026: https://www.tn.gov/commerce/regboards/military-exemption.html covers the temporary exemption only and mentions neither the fee waiver nor the credit. The official code is on a commercial platform.

  • The statutes behind GO-BID certification, and what certification actually buys

    high confidence it exists · Tenn. Code Ann. §§ 12-3-1101 to 12-3-1107, 12-3-401(b), 12-3-503(c), 12-3-514(g); Public Chapter 485

    GO-BID cites those sections as its authority. What they require — whether there is a bid preference, an evaluation credit, a subcontracting goal or a set-aside share attached to service-disabled veteran certification — is the whole of what makes the certification worth holding, and none of it is verified. The published record deliberately claims nothing beyond the certificate and the directory.

    Still needed: The text of Tenn. Code Ann. §§ 12-3-1101 to 1107 and of Public Chapter 485. Tried 23 Aug 2026: no free official host of the Tennessee Code was located — the General Assembly links to a commercial publisher. https://www.tn.gov/generalservices/procurement/central-procurement-office--cpo-/go-bid/go-bid_certification.html was read and cites the sections without quoting them. The Public Chapter text at capitol.tn.gov, or a Central Procurement Office policy manual, is the way in.

  • The statute behind Tennessee veterans treatment courts, and what completion achieves

    high confidence it exists · Tenn. Code Ann. title 16, ch. 6 (Criminal Justice Veterans Compensation Act of 2015), §§ 16-6-101 to 16-6-106

    Twelve veterans treatment courts are named by the Department of Mental Health and Substance Abuse Services, but neither departmental page states an eligibility rule, an offence bar or a consequence of completion. Chapter 16-6 is reported to define a veterans treatment court programme as a stand-alone programme established by a judge exercising criminal jurisdiction or a veterans court track within an existing certified drug court, and that definition alone would sharpen the record considerably.

    Still needed: The text of Tenn. Code Ann. §§ 16-6-101 to 16-6-106. Tried 23 Aug 2026: no free official host of the Tennessee Code was located; https://www.tncourts.gov/press/2021/11/11/specialized-veterans-courts-focus-treatment returned only a browser validation page to direct retrieval. The Administrative Office of the Courts recovery court rules, or a county veterans treatment court publishing its own participant handbook, is the way in.

Massachusetts — 12 on the worklist

Five research passes over Massachusetts law. The fifth added the DV plates at a 60% rating or the functional tests — and flags the c.60A excise exemption as the larger unpublished vehicle benefit.

  • The National Guard tuition and fee waiver statutes — Acts of 2005 ch. 130 and M.G.L. c.33 §137A

    high confidence it exists · Acts of 2005 ch. 130; M.G.L. c.33 §137A(c); M.G.L. c.15A §19

    The published Guard waiver record carries the two administering agencies’ wording, including the 130-hour shared cap and the dependant deadline. The statutory text would settle who counts as a "specified dependant", what happens to the allowance if the member is separated involuntarily, and whether the fee waiver extends to the University system on the same terms as the state universities.

    Still needed: The text of Acts of 2005 ch. 130 and M.G.L. c.33 §137A. Tried 23 Aug 2026: malegislature.gov refused retrieval again, as in prior sessions. The Trial Court Law Libraries’ text of the General Laws, which has served this corpus before, is the way in.

  • Public Service Scholarship — the award amount, the deadline and the application

    high confidence it exists · M.G.L. c.15A §16

    The published record establishes the two eligible groups precisely but carries no award figure, no deadline and no form. A family of a service member killed in action cannot plan around a scholarship whose size nobody publishes.

    Still needed: The Office of Student Financial Assistance’s own page for the Public Service Scholarship and the current award schedule, and the text of M.G.L. c.15A §16. Tried 23 Aug 2026: the Executive Office of Veterans Services page names the office and its contact details but publishes no amount; malegislature.gov refused retrieval.

  • Dental and clinical behavioural health — what the Commonwealth pays for beyond peer outreach

    medium confidence it exists · M.G.L. c.115 §6 (medical and dental costs under Chapter 115)

    The published SAVE record covers peer outreach and referral, not treatment. Chapter 115 is understood to pay medical and dental costs for eligible veterans, which would make Massachusetts one of the few states in this corpus with a genuine state-funded dental route — and the corpus carries nothing on it.

    Still needed: The Executive Office of Veterans Services’ own pages on Chapter 115 medical and dental benefits, and 108 CMR 10.00 on medical care. Not reached 23 Aug 2026; direct retrieval of mass.gov info-details pages was refused throughout the session and only succeeded through a browser.

  • Chapter 115 — the standard budget, the income ceiling and the asset limit

    high confidence it exists · 108 CMR 3.00 (eligibility), 5.00 (determination of benefits), 10.00 (medical care)

    The Chapter 115 record we publish carries no figures for the standard budget, the income ceiling or the asset limit, because the regulations that set them are published only as PDFs. Those figures are the whole of what a veteran wants to know before applying, and the Executive Office reissues a chart each 1 July.

    Still needed: The text of 108 CMR 3.00 and 5.00, and the current desktop budget chart. Tried 22 Aug 2026: the regulation pages at https://www.mass.gov/regulations/108-CMR-500-determination-of-benefits render but carry only a PDF download link, and https://www.mass.gov/doc/108-cmr-5-determination-of-benefits/download returns a “Not allowed” interstitial to direct retrieval. A text rendering of 108 CMR, or the department’s own published budget chart, is the way in.

  • 108 CMR 9.00 — how the burial allowance figures are actually applied

    high confidence it exists · 108 CMR 9.00 (Annuities and burials); M.G.L. c.115 §8

    The published burial record carries the statute as it stands: the burial agent expends not more than $4,000, the whole cost of the funeral and burial must be not more than $5,000, and the commonwealth reimburses the municipality only where the total expense excluding grave, grave opening and vault liner did not exceed $500 for a child under seven or $900 for anyone else. The $4,000 and the $900 sit in the same section and do not read consistently. A grieving family is being told two different numbers and the regulation is what reconciles them.

    Still needed: The text of 108 CMR 9.00. Tried 23 Aug 2026: https://www.mass.gov/regulations/108-CMR-900-annuities-and-burials renders through the browser but carries only a PDF download link; https://www.mass.gov/doc/108-cmr-9-annuities-and-burials/download returns HTTP 403 to direct retrieval and fires a save dialog rather than a page in the browser. A text rendering of 108 CMR, or the Executive Office of Veterans Services’ own burial guidance for burial agents, is the way in.

  • The Servicemembers case statute — Chapter 57 of the Acts of 1943

    high confidence it exists · St. 1943, c.57, as amended through St. 1998, c.142

    The published Servicemembers case record rests entirely on the Land Court’s own FAQ. The act itself would settle the filing deadline for an Answer, who pays the Military Attorney, and whether the Massachusetts procedure adds anything to the federal Act beyond a forum — which is the question that decides whether this is a state benefit or a state formality.

    Still needed: The text of Chapter 57 of the Acts of 1943 as amended by Chapter 142 of the Acts of 1998. Tried 23 Aug 2026: malegislature.gov refused WebFetch (connection refused) and refused browser navigation outright. The Trial Court Law Libraries publish General Laws sections on mass.gov but carry no session laws, so a different route is needed.

  • Deployment protections beyond foreclosure — lease, contract and custody

    medium confidence it exists · M.G.L. c.208 §31A; M.G.L. c.235 §34; M.G.L. c.33

    The corpus now carries the Massachusetts foreclosure court step, but nothing on residential lease termination on deployment or permanent change of station orders, on cell phone, gym or health club contract termination, on an interest rate cap below the federal 6%, on custody protection for a deployed parent, or on whether veteran disability compensation is protected from garnishment. Every one of those would be a first for this corpus, and a deploying reservist needs them in the same week.

    Still needed: The text of M.G.L. c.208 §31A and M.G.L. c.235 §34, and of any service member civil relief provisions in M.G.L. c.33. Tried 23 Aug 2026: the Trial Court Law Libraries publish only selected chapters on mass.gov — https://www.mass.gov/lists/mass-general-laws-c33 and https://www.mass.gov/info-details/mass-general-laws-c33-ss-59 both return Not found, and the c.149 and c.208 list pages link their sections out to malegislature.gov, which refused both retrieval and browser navigation. The Attorney General’s own consumer guidance, or the 2018 Resource guide for veterans and servicemembers the law library cites, is the likely way in.

  • The utility discount rate — which company gives which percentage

    high confidence it exists · Department of Public Utilities approved residential discount tariffs

    The published utilities record carries the Department’s own 25% to 71% range and the three veteran routes onto it, but not the figure any particular household would see. A range that wide is close to useless for deciding whether the paperwork is worth it, and the tiered discount rates ordered by the Department would give a real number.

    Still needed: The approved discount tariffs for Berkshire Gas, Eversource, Liberty Utilities, National Grid and Unitil, and the Department’s Phase I order on tiered discount rates at https://www.mass.gov/doc/phase-i-order-on-tiered-discount-rates/download. Not attempted beyond the Consumer Division page on 23 Aug 2026; mass.gov PDF download URLs refused direct retrieval throughout this session.

  • Veterans Equality Review Board — state benefits after an other than honorable discharge

    high confidence it exists · M.G.L. c.115 §16, as amended by St. 2026, c.101, §23

    The chapter listing shows §16 establishing a Veterans Equality Review Board and state-based veteran benefits for veterans discharged other than honorably under Don’t Ask, Don’t Tell or a similar policy, amended as recently as 12 June 2026. Every discharge test in this state’s corpus currently shuts those veterans out, and a board exists whose whole purpose is to let them back in.

    Still needed: The text of M.G.L. c.115 §16 at https://www.mass.gov/info-details/mass-general-laws-c115-ss-16 and the Executive Office of Veterans Services’ own page for the board. Identified but not read on 23 Aug 2026 — the session’s reading budget went to burial and consumer protections.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Massachusetts has 14 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • The VALOR Act pretrial diversion route for veterans

    high confidence it exists · M.G.L. c. 276A § 10; M.G.L. c. 123 § 35 as it reaches veterans

    Massachusetts is reported to have a statutory pretrial diversion route specifically for veterans and active service members, distinct from the seven Veterans Treatment Court sessions. If it exists in the terms reported, it reaches a defendant in ANY district court rather than only the seven — which would be materially more useful than the transfer route the Trial Court publishes.

    Still needed: The text of M.G.L. c. 276A § 10. Tried 23 Aug 2026: https://malegislature.gov/Laws/GeneralLaws/PartIV/TitleII/Chapter276A/Section10 returned ECONNREFUSED, as malegislature.gov has in prior sessions; mass.gov was reachable in the browser and was read for the Veterans Treatment Courts and transportation pages but carries no VALOR Act diversion page that was found. The Trial Court Law Libraries mirror of the General Laws, which carried c.115 in a prior session, is the way in.

  • Whether any E-ZPass MA discount programme reaches a veteran or disabled-veteran plate

    medium confidence it exists · MassDOT tolling tariff; 700 CMR

    Partly answered and not enough to publish. MassDOT's own Toll payment options page, read in a browser on 23 August 2026, states that only an E-ZPass MA account gives discounted tolls and that Pay By Plate MA and out-of-state E-ZPass accounts give none — but it does not enumerate the special programmes. The page that does, https://www.ezdrivema.com/E-ZPass-MA/Special-Programs, could not be opened: navigation to ezdrivema.com was refused and the host timed out to a plain fetch. The Steamship Authority ferry fares are a separate unanswered question; steamshipauthority.com timed out as well.

    Still needed: The MassDOT or EZDriveMA page enumerating the special discount programmes, and the Steamship Authority's published fare schedule.

Indiana — 12 on the worklist

Three research passes over Indiana law. The third added the DAV licence at $2.75 a year or $27.50 for ten, after in.gov proved unreachable and the regulations digest supplied the fees. Geography is complete for all counties; county tax rates and the local layer are not.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Indiana has 92 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Professional licensing for veterans and military spouses

    high confidence it exists · Ind. Code 25-1-17 (military spouse licensure); Ind. Code 25-25-2-1 (veterans exempt from vending and peddling licence fees)

    The Indiana Professional Licensing Agency runs a military page covering credit for military experience and licences for military spouses holding a current out-of-state licence in a substantially equivalent profession, and Ind. Code 25-25-2-1 appears to give veterans a vending and peddling licence without a fee. None of it could be read at source this session. Every Indiana host refused the connection outright: www.in.gov/pla/professions/military-experience/ and www.in.gov/dva/veterans-services/indiana-professional-licensing-agency/ both returned ECONNREFUSED (208.40.244.65 and .78) to our fetcher, the same URLs were denied at the browser, and iga.in.gov loads only an empty React shell with no statute text at all. A human with an ordinary browser settles this in two minutes.

    Still needed: The PLA military-experience page and the text of Ind. Code 25-1-17 and 25-25-2-1 — read, not summarised.

  • Indiana veteran-owned small business procurement goal

    medium confidence it exists · Ind. Code 5-22-14 (state purchasing preferences)

    Indiana operates a veteran-owned small business category in state purchasing alongside its minority and women’s business enterprise programme, administered by the Department of Administration. The participation goal, the ownership test and the certification route are all unread — in.gov refused every request this session, at the fetcher and at the browser.

    Still needed: The IDOA veteran-owned small business page and the purchasing statute, for the goal percentage and the certification test.

  • Indiana National Guard state education benefits

    high confidence it exists · Ind. Code 21-13-4 (National Guard scholarship extension / supplemental grant)

    Indiana is the only state in this set whose Guard education benefit could not be reached by any route at all on 23 August 2026. www.in.gov refused the connection at IP level from the fetcher and the browser denied navigation to in.gov outright; iga.in.gov continues to serve an empty shell with no statutory text; and the Guard’s own host, www.in.ng.mil, presented an expired TLS certificate and could not be read either. So the credit ceiling, the service obligation, the treatment of a spouse or dependant, and even the correct code citation are all unverified.

    Still needed: The Indiana National Guard education page or the Commission for Higher Education’s Guard scholarship page, plus the governing Ind. Code chapter, for the award formula, the credit or dollar ceiling, the service obligation and whether family members may use it.

  • Free or reduced vital record copies and free DD-214 recording

    medium confidence it exists · To be identified (Ind. Code 16-37 vital records; Ind. Code 10-17 discharge recording)

    A no-fee certified copy of a birth, death or marriage record for a veterans benefit claim, and free county recording of a discharge, are common enough elsewhere that Indiana is likely to have one or both. Neither could be checked: every in.gov host refused the connection at IP level this session, from the fetcher and from the browser, and the Indiana Code viewer serves no text.

    Still needed: The Indiana Department of Health vital records fee page and the county recorder provisions, for whether a veteran fee waiver exists, what it covers, and any limit on the number of copies.

  • State-funded veteran mental health, PTSD or TBI services

    medium confidence it exists · To be identified

    Several states fund a veteran-specific behavioural health navigator, peer support or crisis programme alongside federal provision, and Indiana’s Division of Mental Health and Addiction would be the natural home for one. Nothing could be established either way: the Indiana Department of Veterans Affairs and the Family and Social Services Administration both sit on in.gov, which refused every request at IP level from the fetcher and denied navigation at the browser.

    Still needed: The IDVA services index and the Division of Mental Health and Addiction pages, read for a veteran-specific programme rather than a referral list, before either publishing a record or recording a deliberate absence.

  • State consumer and legal protections beyond the federal SCRA

    medium confidence it exists · To be identified

    Nothing in this corpus covers Indiana lease termination on orders, service-contract cancellation, interest-rate relief, default-judgment protection, custody protection for a deployed parent, or protection of disability compensation from garnishment. Every candidate host for the Indiana Code is blocked to us, and the one non-in.gov county page we reached carried no state law at all.

    Still needed: The Indiana Code from any reachable host, or an Indiana court self-help portal or public university veteran services page that quotes the sections.

  • Utility discounts or a veteran route into energy assistance

    low confidence it exists · To be identified

    Utilities are one of the two thinnest categories in this corpus corpus-wide. Whether Indiana runs a commission-approved veteran discount, a lifeline supplement or a veteran priority inside its energy assistance programme is entirely unresearched, and the state hosts that would answer it are unreachable from here.

    Still needed: The Indiana Utility Regulatory Commission or the state energy assistance programme page, from a reachable host.

  • Which Indiana hosts answer, and how the ones that answer fail

    high confidence it exists · Not applicable — access intelligence

    Tested in a browser on 23 August 2026, so the next round need not repeat it. REFUSED OUTRIGHT: www.in.gov, secure.in.gov (the state web farm, which carries the veterans department, revenue, licensing and the courts), in.ng.mil, allencounty.us. LOADS BUT UNUSABLE: iga.in.gov serves its HTML shell, then the edge answers /static/js/main.*.js with 403 and substitutes index.html, so the application throws "Unexpected token ’<’" and never boots; requests for /pdf-documents/ paths return the same 691-byte HTML with content-type text/html. api.iga.in.gov answers {"error":"403","message":"x-api-key not found"} — a key would open the Indiana Code. archive.iga.in.gov serves real HTML but stops at 2013. REACHABLE: county subdomains of in.gov — hamiltoncounty.in.gov and tippecanoe.in.gov both answered — and indy.gov, though its veterans court page returned HTTP 500 twice.

    Still needed: An Indiana General Assembly API key, or any host outside the state web farm that reproduces the current Indiana Code. Until one of those exists, Indiana statute work has to run through county government pages that quote it.

  • The statewide veterans burial allowance behind the county payments

    high confidence it exists · Ind. Code 10-17-10

    One county figure is now PUBLISHED: in-hamilton-county-burial-benefit (23 August 2026) records Hamilton County’s $500, claimable within a year of death, read from the county’s own veteran services page. That page does not say whether the $500 is the county’s own money, its share of a statewide scheme, or a local top-up — and Indiana appears to run a burial allowance in its own Code, administered by county commissioners and claimed through the county auditor. Whether every one of the 92 counties pays, and at what figure, is unread, and the Code is unreachable.

    Still needed: The text of Ind. Code 10-17-10, and the veteran services or auditor pages of three or four more counties, to establish whether the figure is uniform or local.

  • Which Indiana counties run a certified veterans court

    high confidence it exists · Ind. Code 33-23-16

    One docket is now PUBLISHED: in-hamilton-veterans-court (23 August 2026), read from the county court’s own page, which names Ind. Code 33-23-16 and the Rules for Problem-Solving Courts of the Judicial Conference of Indiana as its authority. What is missing is the statewide picture: the Judicial Conference certifies these courts and publishes a list, and its site sits on the state web farm that refuses us. indy.gov carries a veterans court docket page for the largest county and it returned HTTP 500 on both attempts this session.

    Still needed: The Judicial Conference certified problem-solving court list, or the indy.gov veterans court docket page when it is serving again — plus the statute, for the eligibility gate and what completion earns.

  • The Disabled Hoosier Veteran chapter, on a state host

    high confidence it exists · Ind. Code 9-18.5-5-1, 9-18.5-5-2 and 9-18.5-5-4

    The published plate record now cites these three sections with no link at all, because the reproduction it was built from was removed on 23 August 2026 and no state host would serve the chapter in its place. Two specific things need the primary text. First, the state veterans department is reported to require, on the 50% route only, that at least 60% of the rating be for a mobility disability — a gate the record does not model and that would exclude veterans it currently matches. Second, the plate fee and the vehicle excise credit reported to sit beside it are still unread.

    Still needed: Ind. Code 9-18.5-5 on a state host, or the veterans department eligibility page. Every route tried 23 August 2026 and every one blocked: https://www.in.gov/dva/divisions/training-and-services/veteran-license-plates/eligibility/ and https://www.in.gov/bmv/licenses-permits-ids/ both refused the connection (ECONNREFUSED on 208.40.244.65:443), as did https://www.in.gov/ and https://secure.in.gov/bmv/; a browser navigation to in.gov was denied at the navigation layer. https://iga.in.gov/laws/2025/ic/titles/9 answers with a 691-byte single-page-app shell to a fetch, and in a real browser after an eight-second wait it loads its own script and stylesheet with HTTP 200 but still renders an empty body. http://archive.iga.in.gov IS reachable in a browser, but its coverage stops at 2013 and this chapter was created in the 2016 recodification, so it holds only the superseded IC 9-18-5-5.1. County subdomains of in.gov remain reachable and are the next thing to mine: a county veteran service officer page quoting the eligibility list would at least corroborate the 60% question.

Missouri — 13 on the worklist

Three research passes over Missouri law. The third added the permit exemption, which opens at 60% — lower than most states in this corpus — and reaches nonresidents. Geography is complete for all counties; county tax rates and the local layer are not.

  • Disabled veteran plates, registration and licence fees

    high confidence it exists · To be identified

    Plate fee treatment differs between plate types within a single state, and reading it plate-by-plate is the discipline the Texas Purple Heart record exists to enforce.

    Still needed: A plate-by-plate reading against the current fee schedule.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    The local layer is now OPEN for this state: a flagship transit fare is published. Remaining: every other transit authority, county and municipal programme - the layer is a permanent workstream, not a single record.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • The Missouri Veterans Homes

    high confidence it exists · RSMo ch. 42; 11 CSR 85-1.030

    The Missouri Veterans Commission runs several veterans homes with a published monthly residency rate, a Missouri physical-residency test measured in consecutive days before application, and a cost structure keyed to income, assets and the federal per diem. None of it could be read at source. mvc.dps.mo.gov/homes/admissions/ returns HTTP 403 to our fetcher and, at the browser, an Imperva "Access denied — Error 16" page; revisor.mo.gov refuses the connection outright at both. The wall is site-wide across mo.gov, not specific to this page.

    Still needed: The Commission’s admissions page and 11 CSR 85-1.030, for the eligibility test, the residency day count, the current monthly rate and the treatment of a 70%-or-higher rating.

  • State emergency or relief assistance for veterans

    medium confidence it exists · RSMo ch. 42

    Almost every state runs some form of veterans emergency relief paying rent, utilities, food or funeral costs, and Missouri has a Veterans Commission with its own funding streams that would be the natural home for one. Nothing was verified: mo.gov is blocked site-wide by an Imperva filter, and revisor.mo.gov refused the connection outright from the fetcher and was denied navigation in the browser, so RSMo ch. 42 could not be listed let alone read.

    Still needed: Any reachable mirror of RSMo ch. 42, or a Missouri Veterans Commission page served from a host that is not behind the Imperva filter, for whether a state emergency fund exists and what it pays.

  • Free or reduced vital record copies for a veterans benefit claim

    medium confidence it exists · RSMo 193.265 (vital records fees)

    A no-fee certified copy of a birth, death or marriage record where it is needed for a veterans benefit claim exists in several states, and RSMo 193.265 is the section that would carry it. Neither the section nor the Bureau of Vital Records fee page could be read: revisor.mo.gov refuses the connection and health.mo.gov sits behind the same site-wide Imperva filter as the rest of mo.gov.

    Still needed: RSMo 193.265 and the Bureau of Vital Records fee page from any reachable host, for whether a military or veterans waiver exists, what records it covers, and any copy limit.

  • State veterans cemeteries, burial allowance and county burial duty

    high confidence it exists · RSMo ch. 42

    Missouri operates state veterans cemeteries and is likely to carry county duties around the burial of indigent veterans, but not one fact about either has been read at source. mo.gov is Imperva-blocked site-wide to both the fetcher and the browser, which takes revisor.mo.gov and the Missouri Veterans Commission with it, and moguard.ng.mil does not resolve. The fresh angle tried this session was a search for a Missouri county administering page on its own non-mo.gov domain; it returned only funeral homes, commercial cremation services and federal VA material, with no county government page carrying an RSMo citation.

    Still needed: Any readable host for RSMo ch. 42, or a Missouri county government site on its own domain whose veterans page states the county burial duty and its amount.

  • State consumer and legal protections beyond the federal SCRA

    medium confidence it exists · To be identified

    Lease termination on orders, service-contract cancellation, interest caps, default-judgment and foreclosure protection, custody protection for a deployed parent and garnishment protection for disability compensation are all uncovered for Missouri. The statute site and the courts site both sit behind mo.gov and are unreachable.

    Still needed: RSMo from any readable host, or a Missouri court self-help portal or law school clinic page that quotes the sections.

  • Which Missouri hosts answer, and exactly how the rest refuse

    high confidence it exists · Not applicable — access intelligence

    Tested in a browser on 23 August 2026. IMPERVA/INCAPSULA BLOCK PAGE, served with an incident ID instead of content: mvc.dps.mo.gov (the veterans commission), dor.mo.gov (plates and registration), dhewd.mo.gov (higher education), mostateparks.com. CONNECTION REFUSED: revisor.mo.gov and moga.mo.gov, the two hosts that publish the Revised Statutes; moguard.ng.mil. CLOUDFLARE INTERSTITIAL that never cleared across a wait and two reloads: sos.mo.gov, which publishes the Code of State Regulations. BARE HTTP 403: courts.mo.gov. REACHABLE: mdc.mo.gov (the Department of Conservation, constitutionally independent and hosted separately), veterans.missouri.edu, stlouiscountymo.gov, kcmo.gov.

    Still needed: Any host outside the mo.gov Imperva edge that reproduces the Revised Statutes of Missouri. Until one exists, Missouri statute work has to run through administering institutions and independent agencies that quote it.

  • Veterans treatment courts

    high confidence it exists · To be identified

    Missouri operates treatment courts and veterans dockets among them, and nothing in this corpus records them. The Judiciary’s own host, courts.mo.gov, returned a bare HTTP 403 to the browser this session — not an Imperva page and not a Cloudflare challenge, which suggests a plain edge rule rather than a bot wall and may respond differently from another route.

    Still needed: The Office of State Courts Administrator treatment court pages, for which circuits run a veterans docket, the eligibility gate, and what completion earns.

  • Women veterans provision, and transport to VA medical care

    medium confidence it exists · To be identified

    Both would be answered by the Missouri Veterans Commission, and mvc.dps.mo.gov is behind the Imperva edge that refuses us by IP. Neither topic has any coverage in this corpus for this state. Comparable states run a women veterans coordinator with no separate entitlement, and county-level volunteer driver networks for transport — but neither can be asserted here without reading the commission’s own pages.

    Still needed: The veterans commission’s women veterans page and any transportation page, from any reachable route; failing that, a county veterans service office’s own transport page.

  • The Returning Heroes Act statute and its approved programme list

    high confidence it exists · To be identified (Missouri Returning Heroes’ Education Act)

    The benefit is now PUBLISHED: mo-returning-heroes-education-act (23 August 2026), read from a public university’s own student veterans page, which gives the $50 per credit hour undergraduate cap, the 30% graduate cap, the professional-degree exclusion and the voter-or-resident test. What is unread is the statute itself and the definition of a qualifying combat veteran — the single test that decides who is in — because both the Revisor host and the higher education department host refuse us.

    Still needed: The Act as enacted, for the combat service definition, the approved programme criteria, and whether institutions may set additional conditions.

  • The Gold Star Family plate and the disabled person placard

    high confidence it exists · RSMo 301.142 (placard); RSMo 301.3086 et seq. (Gold Star plates)

    Both certainly exist and neither could be read. The Department of Revenue motor vehicle rules WERE read this session — 12 CSR 10-23 was fetched from s1.sos.mo.gov and parsed in full — and they are no help: the placard rule 12 CSR 10-23.460 was rescinded 30 November 2007, the disabled veterans plate rule 12 CSR 10-23.390 was rescinded 30 May 2006, and the Purple Heart plate rule 12 CSR 10-23.422 was rescinded 28 February 2007. The whole chapter contains no occurrence of Gold Star. That pushes both questions back onto RSMo itself, and revisor.mo.gov did not resolve to curl and refused browser navigation; dor.mo.gov and mvc.dps.mo.gov returned 403 on every attempt.

    Still needed: RSMo 301.142 and the Gold Star plate sections, or a Department of Revenue plate page — through any host that will serve them.

  • Whether Missouri has any tolled crossing a veteran plate could be exempted from

    low confidence it exists · MoDOT tariff, if any

    Unresolved rather than negative. Missouri is generally understood to run no state toll roads, but that could not be established from an administering agency page this session: modot.org returned an HTTP 202 challenge page with no readable content to a plain fetch, and the Department of Transportation's own site could not be read. Publishing an absence needs the agency's own page saying so.

    Still needed: A MoDOT page on tolling, or the absence of one established from a readable MoDOT site map.

Maryland — 10 on the worklist

Five research passes over Maryland law. The fifth added the registration fee waiver, whose gate is functional — loss of use of a hand, arm or leg, total disability, or the statutory vision test — rather than a percentage.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Maryland has 24 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Veteran-Owned Small Business Enterprise procurement goal

    high confidence it exists · Md. Code, State Fin. & Proc. (VSBE programme); COMAR 21.11

    Maryland runs a VSBE programme with a statewide participation goal, certification through eMMA at no cost, and a renewal cycle. The goal percentage is exactly the figure we will not guess at — secondary write-ups disagree between one percent of each agency’s total procurements and a three percent directive for designated agencies, which is precisely why it must be read at source. Both official hosts refused us this session: gomdsmallbiz.maryland.gov/Pages/VSBE-Program.aspx returned HTTP 403 to the fetcher and a bare "403 Forbidden" body at the browser, and procurement.maryland.gov returned 404 on the programme path we had.

    Still needed: The Governor’s Office of Small, Minority and Women Business Affairs VSBE page, for the goal percentage, the federal-verification requirement and the employee cap.

  • Veteran-Owned Small Business Enterprise certification and procurement goal

    high confidence it exists · Md. Code, State Fin. & Proc.

    Maryland certifies veteran-owned small businesses and attaches a participation goal to designated state procurement contracts, with registration running through the eMaryland Marketplace Advantage platform and the goal reported to have moved in 2024. The certifying office’s own site refused every request: gomdsmallbiz.maryland.gov returned 403 Forbidden to the fetcher and served a bare 403 page in the browser, so neither the current goal percentage, the ownership and size tests, the certification term nor the statutory citation could be read first-hand.

    Still needed: The VSBE programme page from a reachable host, or the State Finance and Procurement Article sections behind it, for the current goal percentage and its effective date, the verification required, the certification term and the renewal cycle.

  • Maryland's Commitment to Veterans behavioural health crisis fund

    high confidence it exists · Behavioral Health Administration programme policy

    The care-coordination programme itself is published in this corpus. Sitting inside it is a crisis fund that pays towards a specific bill for a service member, veteran or family member on a case-by-case review — a real cash benefit rather than a referral. The instructions document that carries the maximum award, the eligible expenses and the frequency limit is hosted on health.maryland.gov and returned HTTP 404 on the path we had, and the programme home page does not restate any of it.

    Still needed: The crisis fund instructions from the Behavioral Health Administration, for the maximum award, the eligible expense list, who may apply, and whether an award can be repeated.

  • Maryland National Guard tuition assistance — the operating rules behind the statute

    high confidence it exists · Md. Code, Public Safety §13-405; Military Department programme policy

    The statute is published in this corpus and carries the 100% figure, the 24-month remaining-service test, the institution list and the post-course obligation. What it does not carry is anything a member needs to actually apply: the annual or lifetime cap the Department applies, the semester application deadline, the treatment of graduate study, and how the assistance interacts with federal tuition assistance. military.maryland.gov returned HTTP 403 to every request this session.

    Still needed: The Maryland Military Department tuition assistance page, for the current cap, the semester deadline, and the interaction with federal tuition assistance.

  • Utility discounts or a veteran route into energy assistance

    low confidence it exists · To be identified

    Utilities are one of the two thinnest categories in this corpus corpus-wide, and nothing in the Maryland corpus touches them. Whether the Electric Universal Service Program, the Office of Home Energy Programs or any Public Service Commission tariff carries a veteran eligibility route or priority is entirely unresearched here.

    Still needed: The Office of Home Energy Programs and Public Service Commission pages, checked for a veteran route — and an absence published if there is none.

  • Whether disability compensation is protected from garnishment in Maryland

    medium confidence it exists · Md. Code, Cts. & Jud. Proc. §11-504

    We read §11-504 this session. It contains no veterans-specific exemption. What it does contain is §11-504(b)(2), exempting money payable in the event of sickness, accident, injury or death including compensation for loss of future earnings — immediately qualified by a rule that disability income benefits are not exempt where the judgment is for necessities contracted for after the disability was incurred. Whether a court treats VA disability compensation as inside (b)(2), and how that carve-out bites, is a question of case law rather than of statute text.

    Still needed: Maryland case law or a legal aid clinic guide on how §11-504(b)(2) is applied to VA disability compensation, and whether federal 38 U.S.C. §5301 does the work instead.

  • Transport to VA medical care

    medium confidence it exists · To be identified

    Nothing in the Maryland corpus covers getting a veteran without a car to a VA appointment. The state veterans department’s site was read on 23 August 2026 and its navigation carries no transportation page — the only transport link on it points at the general state driving and motor vehicles hub. County-run vans and volunteer driver networks are the likely home for this and none are researched.

    Still needed: A county veterans service programme’s own transport page, or a state grant funding volunteer drivers — read, not summarised.

  • Beginning farmer and agricultural programmes with a veteran route

    medium confidence it exists · To be identified

    The state veterans department’s Women Veterans and Inclusion Program page, read on 23 August 2026, carries a Business Assistance section and a Rural Communities section but names no agricultural programme at all. Whether the agriculture department or the state’s rural business financing corporation runs a veteran route into beginning-farmer lending, land-link or fee concessions is entirely unresearched.

    Still needed: The agriculture department’s beginning farmer pages and the state rural business financing corporation’s loan programmes, read for a veteran-specific route rather than a general one.

  • Which courts run a veterans docket, and on what terms

    high confidence it exists · To be identified

    The programme is now PUBLISHED: md-veterans-treatment-courts (23 August 2026), read from the Judiciary’s Office of Problem-Solving Courts and its own news release for the Central Maryland regional court. Neither page carries the eligibility gate, the offence range, the programme length or what completion earns, and the Judiciary publishes a problem-solving court coordinators list as a PDF that was not read this session.

    Still needed: The coordinators list, and any court’s published admission criteria — plus the statutory or rule authority for problem-solving courts, which is unread.

Minnesota — 10 on the worklist

Two research passes over Minnesota law. The second added the preference — which now RANKS disabled veterans ahead of all applicants rather than adding the points older guidance describes — and the Minnesota GI Bill at $5,000 a year against a $15,000 lifetime aggregate.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Minnesota has 87 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • State Tuition Reimbursement — the current rate, caps and deadlines

    high confidence it exists · Minn. Stat. §192.501, subd. 2; Minnesota National Guard education circular

    The statute is published in this corpus and gives the formula — the greater of the University of Minnesota Twin Cities lower-division liberal arts rate or 100% of actual tuition at a Minnesota public institution, to a lifetime 144 semester credits. What no source we could read states is the operating detail: the current dollar rate, whether graduate study is reimbursed at a different percentage, any annual maximum, and the application deadline each term. The Guard’s own education page links to circulars rather than stating any of it, and revisor.mn.gov carries only the statute.

    Still needed: The Minnesota National Guard education circular in force, for the current undergraduate and graduate rates, any annual maximum, and the application deadline per term.

  • Free or reduced vital record copies for a veterans benefit claim

    low confidence it exists · Minn. Stat. §144.226

    Minn. Stat. §144.226 was read in full on 23 August 2026 and contains no veteran or military fee waiver at all — the only waiver in the section is for a homeless youth obtaining their own birth record. That is close to a published absence, but it is not quite one: a waiver could sit elsewhere in ch. 144 or in the Department of Health’s own fee policy, and neither was searched exhaustively.

    Still needed: A sweep of Minn. Stat. ch. 144 and the Department of Health vital records fee page, to either find a waiver or establish the absence firmly enough to publish it.

  • Which counties actually maintain a soldiers’ rest

    high confidence it exists · Minn. Stat. §§375.36–375.38; §383A.18

    The rules are now published in this corpus: free space for a veteran and a spouse, and a misdemeanour for charging for a lot. What no state source publishes is which of Minnesota’s 87 counties have exercised the power to buy and designate one, and Ramsey County is carved out of §375.36 with its own duties in §383A.18. Without an inventory the record tells a family the rules but cannot tell them whether their county has the ground.

    Still needed: A county-by-county inventory of designated soldiers’ rest burial grounds, and the Ramsey County arrangements under §383A.18.

  • Utility discounts or a veteran route into energy assistance

    low confidence it exists · To be identified

    Nothing in the Minnesota corpus touches utilities. The Revisor’s own veterans topic index, read this session, lists no entry for leases, contracts or utilities at all — which is evidence of absence in the index rather than proof of absence in the law.

    Still needed: The state energy assistance programme and the Public Utilities Commission cold weather rule, checked for any veteran eligibility route or priority.

  • Transport to VA medical care — the volunteer driver network and the county schemes

    high confidence it exists · To be identified

    This one is close and it was deliberately NOT published. The state veterans department’s own blog carries a detailed account of a county transport service — a county veterans service office paired with a rural transit programme, free to veterans unless they qualify for federal travel reimbursement, using a wheelchair-accessible bus and certified volunteer drivers reimbursed for mileage and meals, part-funded by a small grant from the department. It is dated September 2013. Thirteen years is far too old to publish as current, and the department’s benefits navigation, read in full on 23 August 2026, carries no transportation page at all. The state’s public resource directory also lists regional volunteer driver transportation services across five regions.

    Still needed: A CURRENT county veterans service office transport page, or a department page for the small grants that fund these services — with the year on it.

  • Veterans treatment courts

    high confidence it exists · To be identified

    Minnesota operates treatment courts and veterans dockets among them, and nothing in this corpus records them. The judicial branch’s own site was not reached this session — the round’s effort went to the states where every host was refusing — so this is unresearched rather than blocked.

    Still needed: The judicial branch treatment court pages, for which districts run a veterans docket, the eligibility gate, the statutory authority and what completion earns.

  • Beginning farmer programmes with a veteran route

    medium confidence it exists · Minn. Stat. — to be identified

    The state runs a beginning farmer tax credit and related agricultural lending, and several comparable states give veterans a distinct route or an enhanced rate inside those schemes. Whether this state does, and on what terms, is entirely unresearched. The state veterans department’s navigation, read in full on 23 August 2026, names no agricultural programme.

    Still needed: The agriculture department’s beginning farmer and farm loan pages, read for a veteran-specific route, and the statute behind any credit.

  • The statutory basis for the Women Veterans Program

    medium confidence it exists · Minn. Stat. — to be identified

    The programme is now PUBLISHED as an absence: mn-women-veterans-programme (23 August 2026) records that the department’s stated mission is access, responsiveness and outreach, and that every substantive health and trauma service it names is federal or Guard-run. What is unread is whether Minn. Stat. creates the programme, names a coordinator, or requires anything of the department — which would change the record from an outreach note into an obligation.

    Still needed: The Minn. Stat. section creating or funding the Women Veterans Program, if one exists.

  • State caregiver stipend, respite or veteran-directed home and community-based care

    medium confidence it exists · Minn. Stat. ch. 197; Department of Veterans Affairs programme rules

    Not researched to a conclusion this round. revisor.mn.gov reads cleanly and Minn. Stat. ch. 197 could be searched for a caregiver or respite provision, but mn.gov — where the Department of Veterans Affairs publishes what it actually operates — renders only in a browser from this network and its programme pages were not reached this session.

    Still needed: Minn. Stat. ch. 197 searched for caregiver, respite and adult day provisions, plus the department's own programme page for whichever exists.

Wisconsin — 19 on the worklist

Two research passes over Wisconsin law. The second added the Wisconsin GI Bill: full tuition and segregated fees remitted for 128 credits or 8 semesters, whichever is LONGER — with the residency root changing for summer 2026 to entry-as-resident or three consecutive years.

  • Hunting, fishing and state park concessions

    high confidence it exists · Wis. Stat. ch. 29

    Wisconsin is reported to run reduced-fee licences for disabled veterans and free fishing for some categories. Thresholds ranged from any-degree to 100% across the states we have researched, so nothing is assumed here.

    Still needed: The DNR pages or statutes, read directly, with the thresholds and what each concession covers.

  • Disabled veteran plates, registration and licence fees

    high confidence it exists · To be identified

    Plate fee treatment differs between plate types within a single state, and reading it plate-by-plate is the discipline the Texas Purple Heart record exists to enforce.

    Still needed: A plate-by-plate reading against the current fee schedule.

  • Veterans preference points in public employment

    high confidence it exists · Wis. Stat. §230.16; §321.65

    One half of this is now PUBLISHED: wi-veterans-non-competitive-appointment (23 August 2026) records the appointment route for a 30% disabled veteran, read from WDVA’s own State of Wisconsin Employment page. That page says nothing at all about examination preference points, which is the other half — reported as 5 for a veteran and up to 10 more for a disabled veteran, with interview provisions besides. WDVA does not publish it and the statute site refuses connections from here.

    Still needed: The point values, the disabled tiers and any spouse route, from Wis. Stat. §230.16 or from the Division of Personnel Management’s own pages — not from WDVA, which does not carry them.

  • County and municipal veteran programmes

    medium confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Wisconsin has 72 counties and none are researched.

    Still needed: Operator and county-level research, starting with the largest metropolitan areas.

  • Disabled veteran-owned business certification and procurement preference

    high confidence it exists · Wis. Stat. 16.75(3m); Wis. Adm. Code Adm 82.50

    Wisconsin certifies disabled veteran-owned businesses and attaches a price preference on state procurement contracts, with certification reportedly running three years. The ownership test, the disability test, the preference percentage and the fee are all unread: dva.wi.gov timed out at DNS on every attempt from both the fetcher and the browser, and docs.legis.wisconsin.gov refused the connection for both the statute and Adm 82.50.

    Still needed: The WDVA veteran-owned business page and Adm 82.50, for the certification test, the term, the fee and the preference percentage.

  • The statute behind subsistence aid and health care aid

    high confidence it exists · Wis. Stat. ch. 45

    Both grants are now PUBLISHED (wi-subsistence-aid-grant and wi-health-care-aid-grant, 23 August 2026) from WDVA’s own page, reached by navigating to wisvets.com and following its redirect into dva.wi.gov — direct navigation to dva.wi.gov is still refused, and that redirect is the trick that opened the whole department. What remains unread is the law: WDVA publishes the caps, the deadline and the routing but no income test, no asset test, no residency period and no discharge standard, and docs.legis.wisconsin.gov, legis.wisconsin.gov and the whole wisconsin.gov namespace still refuse connections from here.

    Still needed: The ch. 45 provisions behind the two grants, for the income and asset tests, the residency period, the discharge standard, and whether the $7,500 lifetime cap is statutory or departmental.

  • The three veterans homes, and the veteran plate schedule

    high confidence it exists · Wis. Stat. ch. 45; Wis. Stat. ch. 341

    Both sit one click away from pages we DID read on 23 August 2026 and both failed for different reasons. The veterans homes overview at dva.wi.gov/services/wisconsin-veterans-homes/ threw a fetch failure on a host that answered every other request in the same batch, and the three homes themselves live on a separate domain, wisvetshomes.com, which was not tried. The veteran and disabled veteran plate pages are on the transport department host, which refuses connections from here entirely.

    Still needed: The veterans homes eligibility, cost-of-care and admission pages from dva.wi.gov or wisvetshomes.com; and the veteran plate and disabled veteran plate fee schedule from the transport department, from any reachable host.

  • Wisconsin National Guard tuition grant

    high confidence it exists · Wis. Stat. §21.49

    A state tuition grant for Guard members is close to universal and Wisconsin operates one, reportedly reimbursing a percentage of tuition at Wisconsin institutions with a service obligation attached. The percentage, the institution list, the credit ceiling and the obligation are all unread. On 23 August 2026 the wall widened rather than narrowed: dva.wi.gov still times out at DNS, docs.legis.wisconsin.gov still refuses the connection, and dwd.wisconsin.gov timed out at DNS as well — so the whole wisconsin.gov namespace is now known to be unreachable to us, not just the department host.

    Still needed: Wis. Stat. §21.49 or the Wisconsin Department of Military Affairs education page, from a host outside the wi.gov and wisconsin.gov namespaces, for the reimbursement percentage, the eligible institutions and the service obligation.

  • Free vital record copies and free discharge recording

    medium confidence it exists · Wis. Stat. ch. 69 (vital records); Wis. Stat. §45.43 (discharge recording)

    No-fee certified copies for a veterans benefit claim, and free recording of a discharge with the register of deeds, exist in several states and are the kind of provision Wisconsin would carry in ch. 69 or ch. 45. Nothing could be checked: every wi.gov and wisconsin.gov host we tried was unreachable at DNS or refused the connection this session.

    Still needed: The Wisconsin vital records fee schedule and the discharge recording provisions, for whether a veteran waiver exists, which records it covers and any copy limit.

  • State supplement to adapted housing or home modification

    low confidence it exists · Wis. Stat. ch. 45

    Some states top up the federal specially adapted housing grant or run their own home-modification programme for disabled veterans. Whether Wisconsin does is unknown rather than unlikely — the department that would run it, WDVA, has been unreachable to this corpus across two sessions, so no absence can honestly be recorded either.

    Still needed: The WDVA benefits index, read for a housing adaptation or modification programme, before either publishing a record or recording a deliberate absence.

  • Wisconsin Department of Military Affairs — a reachable host for future rounds

    high confidence it exists · Wis. Stat. ch. 321

    This is a research lead rather than a benefit. The whole wisconsin.gov namespace is unreachable to us, dva.wi.gov with it, which has capped every Wisconsin round so far. On 23 August 2026 dma.wi.gov answered normally to the fetcher and served the National Guard Tuition Grant programme page and its FAQ in full. Anything the Department of Military Affairs administers or republishes is therefore readable, even while WDVA is dark.

    Still needed: A sweep of dma.wi.gov for Guard family programmes, legal assistance, state active duty protections and any republished Wis. Stat. ch. 321 material.

  • Wisconsin servicemember protections on state active duty

    high confidence it exists · Wis. Stat. §321.62

    Wisconsin appears to have its own servicemember relief section covering residential lease termination on state active duty, a bar on early-termination charges, refund of advance rent, protection of personal property left behind, and a power for the court to modify the relief on a landlord’s application. None of it has been read at source: docs.legis.wisconsin.gov is unreachable, and dma.wi.gov returned 404 on the SCRA path we had.

    Still needed: Wis. Stat. §321.62 in full from any reachable host, or a Department of Military Affairs page that restates the notice period, the 30-day rule and the refund obligation.

  • National Guard Tuition Grant — recoupment and the federal interaction

    high confidence it exists · Wis. Stat. §321.40

    The grant itself is now published in this corpus from the department’s own FAQ. What the FAQ does not answer is what happens on a mid-term separation and how the grant sits alongside federal tuition assistance or the federal GI Bill. The department publishes a Reference Manual and a Single-Term Recoupments Manual that should carry both, and both were listed but not read this session.

    Still needed: The Reference Manual and the Single-Term Recoupments Manual at dma.wi.gov, for the recoupment triggers, the repayment window and the federal-benefit interaction.

  • Wisconsin burial allowance, grave markers and county duties

    medium confidence it exists · To be identified

    The state veterans cemeteries are already published in this corpus. What is not is any burial allowance, headstone-setting reimbursement, county indigent burial duty or funeral-honours stipend. The fresh angle tried this session was two county veterans service office sites on their own domains: fdlco.wi.gov returned HTTP 403, and oneidacountywi.gov loaded but describes only federal VA burial allowances, markers, medallions and flags, quoting no Wis. Stat. section and no Wisconsin dollar figure.

    Still needed: A Wisconsin state source for any burial payment, or confirmation from a readable state page that none exists — which would be worth publishing as an absence.

  • The host route that opened WDVA, recorded so it is not lost

    high confidence it exists · Not applicable — access intelligence

    Four rounds treated dva.wi.gov as dark. On 23 August 2026 navigating to wisvets.com — WDVA’s older public domain — followed its redirect into dva.wi.gov successfully, and once the browser held that origin every WDVA page could be fetched same-origin. Direct navigation to dva.wi.gov was still refused before and after. revenue.wi.gov also answers directly. Everything under wisconsin.gov (dwd, dnr, doa, dsps, legis, docs.legis) and the transport department host refuse connections.

    Still needed: Nothing to verify — this exists so the next round starts from wisvets.com rather than re-testing a host that refuses.

  • Transport to VA medical care

    medium confidence it exists · To be identified

    Nothing in the Wisconsin corpus covers getting a veteran without a car to a VA appointment. WDVA’s benefits tree, read in full on 23 August 2026, has no transportation page: the only transport reference anywhere on it is a line in the Veterans Housing and Recovery Program saying transportation assistance is available to residents. County veterans service offices and volunteer driver networks are the likely home for this and neither is researched.

    Still needed: A county veterans service office’s own transport page, or a WDVA or county grant programme funding volunteer drivers — read, not summarised.

  • Veteran and disabled veteran licence plates — eligibility, fees and whether the DV plate confers parking

    high confidence it exists · Wis. Stat. ch. 341; Department of Transportation plate pages

    This state has no vehicle record at all in the corpus, and the Department of Veterans Affairs navigation names two plate pages — Veteran License Plates and Disabled Veteran License Plate — but both links leave the veterans site for the transportation department. Whether the disabled veteran plate carries accessible parking is the question that decides whether a veteran gets ticketed, and it cannot be answered from the veterans site.

    Still needed: https://wisconsindot.gov/Pages/dmv/vehicles/title-plates/military.aspx and https://wisconsindot.gov/Pages/dmv/vehicles/dsbld-prkg/dvetplat.aspx. Tried 23 Aug 2026: dva.wi.gov reads fully through the wisvets.com route and both links were resolved from its navigation; wisconsindot.gov refused the connection outright for both URLs, returning no HTTP status at all.

  • Home Energy Plus income guidelines — the figures that decide whether a veteran household qualifies

    high confidence it exists · Wisconsin Home Energy Assistance Program guidelines; Department of Administration

    The published record establishes the veteran route into the energy programme and what it pays for, but the income guidelines are published as an image on the campaign page and the figures could not be read. A veteran can be told the programme exists and cannot be told whether their income clears the line, which is the only question that matters before applying.

    Still needed: The Home Energy Plus income guidelines table for the current programme year. Tried 23 Aug 2026: heat4heroes.org reads and displays the guidelines only as an image; the Department of Administration programme pages sit under wisconsin.gov, which refused retrieval.

  • Whether the state funds any caregiver stipend, respite or adult day health route for veteran households

    medium confidence it exists · Wis. Stat. ch. 45; Department of Veterans Affairs programme pages

    The Department of Veterans Affairs benefits navigation was enumerated in full this session — education, employment, grants, outdoor recreation, driver licensing, mental health and recovery, housing and financial services, the veterans homes, cemeteries and military honors — and carries no caregiver, respite or adult day heading anywhere in it. That is suggestive of an absence but not proof of one, and an absence worth publishing needs a page that positively addresses caregivers.

    Still needed: Any Department of Veterans Affairs caregiver page, or confirmation from its site search that none exists. Tried 23 Aug 2026: dva.wi.gov read fully through the wisvets.com route and its whole benefits and services navigation was enumerated; no caregiver page was found in it.

Oklahoma — 12 on the worklist

A first pass over Oklahoma statewide law: the full homestead exemption and the sales tax exemption card, both read from the Tax Commission’s own publications. Geography is complete for all 77 counties; county tax rates and the local layer are not.

  • Vital record furnished without fee for a claim to the federal department

    high confidence it exists · 63 O.S. §1-325; Okla. Admin. Code 310:105-1-3

    A fee waiver for a copy submitted in connection with a claim for military service-connected benefits appears to sit in the vital statistics fee rules, and the statute section is titled for fees, noncollectible drafts and enlistees. Neither could be read. The health department's own birth certificate pages carry no fee schedule and no exemption list at all — they route the applicant to a third-party ordering service.

    Still needed: 63 O.S. §1-325 and Okla. Admin. Code 310:105-1-3, read directly. Pages read and found silent: https://oklahoma.gov/health/services/birth-and-death-certificates/birth-certificates.html and https://oklahoma.gov/funeral/rules-and-statutes/title-63-article-3-vital-statistics.html (which lists the section title and links to the Statutes host, which refuses connections).

  • National Guard Educational Assistance — service obligation and repayment

    medium confidence it exists · To be identified (44 O.S.)

    The programme is now published from the Regents' own pages, read 23 August 2026 — resident tuition, mandatory fees and academic service fees, 18 hours a semester, 120 undergraduate and 40 graduate hours, GPA floors and application windows. What is not published on those pages is the length of the service obligation after the last funded semester, or how a repayment is calculated when a member fails the conditions. The Military Department's own education pages returned HTTP 403.

    Still needed: The statute creating the programme, and the Military Department regulation. Blocked this session: https://ok.ng.mil/eap/ (403) and the Statutes host (ECONNREFUSED).

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Oklahoma has 77 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State emergency or hardship financial assistance for veterans

    medium confidence it exists · To be identified (72 O.S.)

    Neighbouring states run a state-funded emergency grant for rent, utilities, medical or transport costs. Nothing of the kind appears on the state veterans agency's own benefits page, veterans-services page or state benefit request page, all read 22 August 2026 — what those pages carry is plates, tax relief, parks, hunting and fishing, and federal programmes. Either no such fund exists here, or it is not published where a veteran would look.

    Still needed: Read the veterans title of the statutes for an assistance or relief fund, and ask the agency directly. Pages read and found silent: https://oklahoma.gov/veterans/benefits.html, https://oklahoma.gov/veterans/veterans-services.html, https://oklahoma.gov/veterans/benefits/state-benefit-request.html

  • What the state parks and museums admission waiver is actually worth

    high confidence it exists · Oklahoma Tourism and Recreation Department fee schedule

    The admission waiver is published, but no fee schedule has been read, so the record carries no dollar figure. Whether camping, lodging and in-park charges are separate is also unstated, as is whether a spouse or family in the same vehicle is covered.

    Still needed: The parks department's own fee schedule and veteran admission policy, read directly.

  • Cancelling a cell phone, gym, satellite or other consumer contract on deployment

    medium confidence it exists · To be identified (Okla. Stat. tit. 15)

    Title 41 was read end to end this session and carries no military provision at all, which is now published as an absence. That answers leases only. Whether a servicemember may cancel a term consumer contract — mobile phone, gym membership, satellite or cable — on deployment orders was not established, and it is the question people ask straight after the lease one.

    Still needed: Okla. Stat. tit. 15, and any consumer-protection article of the statutes, read directly from the Senate's published titles. Titles read this session and found silent on it: tit. 41 (https://oksenate.gov/sites/default/files/2019-12/os41.pdf), tit. 31 (https://oksenate.gov/sites/default/files/2022-05/os31.pdf) and tit. 43 (https://oksenate.gov/sites/default/files/2022-05/os43.pdf).

  • Any state interest-rate relief for a servicemember below the federal 6 percent

    medium confidence it exists · To be identified (Okla. Stat. tit. 14A, Uniform Consumer Credit Code)

    The federal Servicemembers Civil Relief Act caps interest on pre-service obligations at 6 percent. Several states legislate below that or extend it further. Nothing read this session establishes whether this state does, and no state civil relief act was found in the three titles read.

    Still needed: Okla. Stat. tit. 14A read directly, and a search of the statutes for a state servicemembers civil relief act. The case-law host oscn.net refuses connections.

  • State or county funded transport to VA hospitals and clinics

    medium confidence it exists · To be identified — no authority found in Okla. Stat. tit. 72

    Title 72, the state veterans title, was read end to end on 23 August 2026 and the word "transport" does not appear in it once. The routes that surfaced this session are federal or charitable — the VA Veterans Transportation Service at the Oklahoma City and Muskogee facilities, and the DAV van network whose hospital service coordinators work through county veterans directors. Neither is a state benefit, and neither belongs in this corpus as one.

    Still needed: A state or county page describing a state-funded or county-funded veterans transport service, mileage or fare reimbursement, or a rural transport grant. Read this session and silent: Okla. Stat. tit. 72 (https://oksenate.gov/sites/default/files/2022-05/os72.pdf). Not yet read: the state veterans department benefits index (https://oklahoma.gov/veterans/benefits.html), the department of transportation public-transit programme, and any of the 77 county veterans service offices.

  • Which counties run a veterans treatment court, and under what authority

    high confidence it exists · To be identified — not in Okla. Stat. tit. 22 as published

    Title 22, Criminal Procedure, was read end to end this session looking for a veterans treatment court. The compilation contains no such court. The only veteran provision in the whole title is the PTSD sentencing factor at §22-973a, now published. Counties do operate veterans dockets, and the Legislature has been reported as authorising district and municipal courts to establish a veterans treatment programme — but the section number, the eligibility gate and what completion earns were not established from any statute or court page this session.

    Still needed: The current codified section creating the programme, and a district court or district attorney page setting out the eligibility gate, the offences accepted, and whether completion earns dismissal or expungement. Read this session and silent: Okla. Stat. tit. 22 (https://oksenate.gov/sites/default/files/2019-12/os22.pdf), which is the 2019 compilation and so would not carry a later enactment.

  • Whether any turnpike toll exemption or free PIKEPASS exists for a disabled veteran, Purple Heart or Medal of Honor plate

    medium confidence it exists · Okla. Stat. tit. 69 (Turnpike Authority); Turnpike Authority policy

    Toll relief is a live benefit in several states and nothing on it has been read for this state. The turnpike authority's own site on oklahoma.gov was read end to end on 23 August 2026: it has no fee or exemption page at all, and every link on it about tolls points off-site to the tolling brand. That is a silence, not a finding — it does not establish that no exemption exists.

    Still needed: The tolling operator's own fee or exemption page, or the statute. https://pikepass.com/ , https://pikepass.com/customer-service/faq and https://www.pikepass.com/CustomerService/FAQ all answered HTTP 403 to a fetch on 23 August 2026 and a browser session returned an Incapsula block page with an incident ID. https://oklahoma.gov/ota.html read fine and carries no exemption content. The state courts network that publishes the statutes (https://www.oscn.net/) refused every connection.

  • A state-funded caregiver stipend, respite or veteran-directed care route

    medium confidence it exists · To be identified — Oklahoma Human Services aging and disability programmes

    The state motor vehicle and disability services page read on 23 August 2026 lists a Respite Voucher Program and Family Support Assistance, but describes both as general disability programmes with no veteran route, and the state veterans department's benefits page names no caregiver or respite programme at all. Whether a veteran-directed care programme operates here through the aging network is unresolved.

    Still needed: The human services department's own respite and aging pages, and the veterans department's own caregiver page if one exists, read directly.

  • The administrative rule behind the disabled veteran plate

    high confidence it exists · Okla. Admin. Code §260:135-7-152

    The published record ok-dav-plates was re-sourced on 23 August 2026 onto the motor vehicle agency’s own catalogue and military pages, because its only source had been a commercial mirror of this rule. The agency pages give the 50% gate, the two-vehicle limit, the documentation and the fees, but not the rule text — so the one-ton vehicle limit previously attributed to the rule is now unsupported, and whether the rule adds conditions the agency pages omit is unresolved.

    Still needed: Okla. Admin. Code §260:135-7-152 read directly. Every primary host refused on 23 August 2026: https://www.oscn.net/ refused every connection, https://rules.ok.gov/code answered HTTP 403 and held at a Cloudflare challenge that did not clear after nine seconds in a browser session, and https://www.sos.ok.gov/oar/code/ answered HTTP 401.

South Carolina — 14 on the worklist

A first pass over South Carolina statewide law: the total property tax exemption, read from SCDOR’s own guidance including the 2024 expansion to five acres and same-year claims. Geography is complete for all 46 counties; county tax rates and the local layer are not.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. South Carolina has 46 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State veterans' homes — the resident charge, the locations and the waiting list

    high confidence it exists · S.C. Code §§25-11-710 to 25-11-730

    Article 7 was read in full on 23 August 2026 from scstatehouse.gov and is now published as a record: the department may operate the homes, the definition of a qualifying veteran is discharge under other than dishonorable conditions, and since 28 April 2025 the department adopts the admission and discharge criteria and sets and collects the fees. What the statute does NOT contain is a single number — no fee, no bed count, no list of homes.

    Still needed: The department admission packet, which carries the resident charge and names the homes. scdva.sc.gov returned an Amazon CloudFront country block to every request this session, both for https://scdva.sc.gov/veterans-homes and for the site root. Retry from a different network, or find the fee in a promulgated regulation.

  • Veteran-owned business certification or procurement preference

    medium confidence it exists · S.C. Code tit. 11, ch. 35 (Consolidated Procurement Code)

    The Consolidated Procurement Code was read in full on 23 August 2026 and the silence is now published as a record: §11-35-1524 builds seven preferences at 2%, 4% and 7% for end products, in-state offices and inventory, manufacturing and labour, and the words "veteran" and "service-disabled" appear nowhere in the chapter. What remains open is whether a certification programme, an appropriations proviso or an individual solicitation creates something the Code does not.

    Still needed: The Division of Small and Minority Business Contracting and Certification pages, and any appropriations proviso creating a preference. Chapter read and published from: https://www.scstatehouse.gov/code/t11c035.php

  • Veterans' Trust Fund — whether an individual can ever be paid from it

    high confidence it exists · S.C. Code §§25-21-10 to 25-21-40

    Chapter 21 was read in full on 22 August 2026. It creates an eleemosynary corporation with a board of trustees that may set grant criteria and disburse monies, and describes funding partnerships with charitable organisations, veterans service organisations and county veterans affairs officers. Nothing in the chapter creates an application route for an individual veteran, and the fund's own site describes grants to organisations. Whether an individual is ever paid — and on what terms — is unresolved.

    Still needed: The board's published grant criteria and any application form. The agency's own pages (scdva.sc.gov) refused every connection this session; scveteranstrustfund.org was read and describes organisational grants only.

  • Veterans preference — whether any points table exists behind the statute

    high confidence it exists · S.C. Code §1-1-550; state human resources procedure

    The general preference is now published from §1-1-550, read 23 August 2026: preference for appointment and employment in every public department and on all public works, mirroring the federal preference, qualified twice by "insofar as such preference may be practicable". The section sets NO points of its own. Guides routinely describe a five- and ten-point scheme and an interview requirement here; if either exists it comes from the hiring authority's own rules, not from the section.

    Still needed: The state human resources division's own hiring procedure, read directly, and any agency rule setting points or an interview guarantee. scdva.sc.gov refused every connection this session. Section read and published from: https://www.scstatehouse.gov/code/t01c001.php

  • Which office makes the free vital-record request the statute routes through

    medium confidence it exists · S.C. Code §44-63-110

    The waiver is now published: verification needed for Veterans Administration purposes in connection with a claim must be furnished without charge — but to the "Veterans' Affairs Department of the Governor's Office" or a county veterans affairs officer, on request. That office name reflects where the function sat when the section was written, and the veterans department is now a separate agency. A veteran needs to know which door to knock on today.

    Still needed: The state veterans department's own guidance on requesting records for a claim, and confirmation of which office the vital records registrar accepts requests from. scdva.sc.gov refused every connection this session.

  • Cancelling a cell phone, gym, satellite or other consumer contract on deployment

    medium confidence it exists · To be identified (S.C. Code Title 37, Consumer Protection Code)

    The residential landlord and tenant chapter and the military title's general provisions chapter were both read end to end this session and neither carries a servicemember termination right; that absence is now published for leases. Whether a term consumer contract can be cancelled on deployment orders was not established.

    Still needed: S.C. Code Title 37 read directly at https://www.scstatehouse.gov/code/title37.php . Chapters read and found silent: https://www.scstatehouse.gov/code/t27c040.php and https://www.scstatehouse.gov/code/t25c001.php .

  • What counts as a veteran for the $50 energy assistance add-on, and whether it is once per household

    high confidence it exists · S.C. LIHEAP Detailed Model Plan; 42 U.S.C. 8624 state plan

    The state's LIHEAP model plan, read 23 August 2026, gives a household with at least one veteran an additional $50 toward the non-emergency energy benefit, on a $200 base with an $850 ceiling. It does not define veteran for that purpose, does not say what proof the local agency wants, and does not say whether two veterans in a household mean $50 or $100.

    Still needed: The Community Action Agency intake policy, or the state office's guidance to local agencies. Plan read: https://oeo.sc.gov/managedsites/prd/oeo/documents/25%20South%20Carolina%20LIHEAP%20Model%20Plan%20effective%202025.pdf

  • Which circuits actually run a veterans treatment court, and what completion earns

    high confidence it exists · S.C. Code §§14-29-10 to 14-29-30

    The Veterans Treatment Court Program Act was read in full on 23 August 2026 and is now published. It is three sections long: each circuit solicitor MAY establish a programme, one that accepts state funding MUST establish one within 180 days and must let all eligible persons apply. The Act sets no eligibility list, names no offences and states no consequence of completion. Every one of those is local.

    Still needed: A circuit solicitor page or judicial branch listing naming the circuits that operate a programme, with the local eligibility criteria and whether completion earns dismissal or expungement. Read this session and silent on all of it: https://www.scstatehouse.gov/code/t14c029.php. Unreachable this session: sccourts.org treatment-court pages returned no content, and scdva.sc.gov is country-blocked.

  • Whether the state runs a women veterans programme or coordinator post

    medium confidence it exists · To be identified — nothing in S.C. Code tit. 25, ch. 11

    Chapter 11 of Title 25, the whole veterans chapter, was read on 23 August 2026 and the word "women" does not appear in it once. If a women veterans programme exists here it is administrative, not statutory, and would be described on the department's own pages.

    Still needed: The department page at https://scdva.sc.gov/women-veterans, which returned an Amazon CloudFront country block this session, as did every other path on that host. Read this session and silent: https://www.scstatehouse.gov/code/t25c011.php.

  • Homegrown By Heroes and any state farm-funding route for veterans

    medium confidence it exists · Department of Agriculture programme policy

    The agriculture department's own navigation lists a Homegrown By Heroes programme under its marketing division, and a 2020 departmental news item describes the label as a branding campaign run by a national coalition with grants of up to $5,000 from that coalition rather than from the State. Whether the department itself certifies producers, charges a fee, or funds anything was not established.

    Still needed: The programme page itself. https://agriculture.sc.gov/divisions/external-affairs-economic-development/marketing/homegrown-by-heroes returned only the site chrome with no programme content, and the same path with a trailing slash returned HTTP 403. Read this session: https://agriculture.sc.gov/funding-networking-available-for-sc-farmer-veterans/, which is a 2020 news story about the national coalition and not a statement of a state benefit.

  • State or county funded transport to VA hospitals and clinics

    medium confidence it exists · To be identified — no authority in S.C. Code tit. 25, ch. 11

    Chapter 11 of Title 25 was read in full on 23 August 2026. Transport appears once, at §25-11-20(D)(2), and only as one of the subjects the secretary must coordinate with other agencies about. No section creates a transport service, a mileage payment or a fare concession.

    Still needed: A county veterans' affairs office page or a state transport programme page describing a funded service, and confirmation of whether the county offices themselves run vans. Read this session and silent on any benefit: https://www.scstatehouse.gov/code/t25c011.php. The department site that would list county offices is country-blocked.

  • Whether the state toll facilities exempt or discount a disabled veteran, Purple Heart or Gold Star plate

    medium confidence it exists · S.C. Code tit. 57 (highways); toll facility operating agreements

    The plate chapter read on 23 August 2026 grants free metered and timed PARKING to the exemplary and distinguished service award plates, but says nothing about tolls. Whether the state's toll facilities carry a parallel exemption is unread.

    Still needed: The transportation department's own toll roads page and the operating agreements behind the facilities, read directly. https://www.scdot.org/travel/travel-tollroads.aspx answered HTTP 404 on 23 August 2026.

  • State-funded caregiver support, respite or adult day health with a veteran route

    medium confidence it exists · To be identified — Department on Aging; Department of Health and Human Services

    Nothing on caregiver support or respite has been read for this state, and the veterans department's own site remains unreachable from here. The population is ageing and this is the thinnest topic in the corpus.

    Still needed: The Department on Aging's own family caregiver support pages and any veteran-directed care listing, read directly. The state veterans department site remains behind a country block that has defeated every attempt in this corpus.

West Virginia — 18 on the worklist

A first pass over West Virginia statewide law: the refundable disabled veteran real property tax credit, new for tax year 2024. Geography is complete for all 55 counties; county tax rates and the local layer are not.

  • Military retirement income tax exemption

    high confidence it exists · W. Va. Code §11-21-12

    Full exemption reported under W. Va. Code 11-21-12. Still unpublishable: code.wvlegislature.gov renders an EMPTY BODY in a rendered browser (the iga.in.gov failure mode), and the tax division publication is a scanned PDF. The veterans department state-benefits page - which cleared four other categories on 2026-08-21 - does not mention retirement income at all, which is itself odd and worth confirming.

    Still needed: The statute or the administering agency page, read directly.

  • Veterans preference in state employment

    high confidence it exists · To be identified

    Every mature state operates one; the mechanics differ.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. West Virginia has 55 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Initial occupational licensing fee waiver for military families, and military spouse temporary licensure

    high confidence it exists · W. Va. Code §§30-1-24, 30-1B-5

    Boards are required to waive initial occupational licensing fees for a defined class that includes serving members, honourably discharged veterans and their spouses, and there is a separate temporary licence for the spouse of a person on military active duty. The definitions, the waiver scope and the temporary licence term all need reading first-hand.

    Still needed: code.wvlegislature.gov returned HTTP 403 to every request this session, and wvbom.wv.gov refused the connection. Read the two sections from the Legislature, and pair them with one board's own waiver page.

  • State veterans nursing facility at Clarksburg — admission and cost

    high confidence it exists · W. Va. Code ch. 9A; legislative rule

    The 120-bed nursing facility is the skilled-care counterpart to the Barboursville home and is a different admission entirely — a residency test measured in months, a Medicare and Medicaid level-of-care test, and a restricted non-veteran spouse route tied to occupancy above 75 percent of licensed beds.

    Still needed: The facility page at veterans.wv.gov carries the address, bed count and a general statement that cost is below the national average, but no eligibility or charging detail. Read the department's admission policy or the legislative rule directly.

  • State-funded emergency or hardship assistance for veterans

    medium confidence it exists · W. Va. Code ch. 9A

    The department's own Economic Assistance page was read on 22 August 2026. Every item of direct financial help on it is either federal or run by a charity — the American Legion, the VFW, Operation First Response, USA Cares and others. No state-funded emergency grant appears. Whether ch. 9A creates one is unresolved.

    Still needed: code.wvlegislature.gov returned HTTP 403 this session, including through the www.wvlegislature.gov redirect. Read ch. 9A from another legislative source, or ask the department directly. Page read and found silent: https://veterans.wv.gov/Pages/economicsassistance.aspx

  • Free or reduced vital records for a claim to the federal department

    medium confidence it exists · W. Va. Code §16-5-24

    The state health department's own certificate request page was read on 23 August 2026. It states the cost of a certificate is $12 per copy including a non-refundable search fee, and it names NO exemption or waiver of any kind — not for veterans, not for a claim to the federal department, not for anyone. Either no waiver exists, or the office does not publish it where an applicant would look.

    Still needed: W. Va. Code §16-5-24 read directly. The Code host returned HTTP 403 on every attempt this session, including through the www.wvlegislature.gov redirect. Page read and found silent: https://dhhr.wv.gov/HSC/VR/CR/Pages/default.aspx

  • Guard Educational Encouragement Program — service obligation and repayment

    high confidence it exists · To be identified

    The programme is now published from the Guard's own application system, read 23 August 2026: up to $10,000 per service member per fiscal year as prescribed by the Adjutant General, deadlines of 1 May and 1 November, drilling members only, in-state accredited institutions, no refund to the student. What the system does not state is whether accepting an award creates a service obligation, or what a member repays if they separate. Comparable state Guard programmes in this corpus all carry one.

    Still needed: The Guard's own education regulation or statement of agreement, read directly. Page read: https://apps.wv.gov/WVEEP/Home/About

  • RAFT and the Governor's Challenge — whether either pays for care

    medium confidence it exists · To be identified

    The department describes Resource Availability Family Tapestry, established in 2023, as a comprehensive approach to prevention, intervention and postvention for those at risk of suicide, and co-leads the Governor's Challenge with the state Bureau for Behavioral Health. Neither page says whether either programme funds or pays for treatment, or how an individual enters it — which is the difference between a benefit and a coordinating body.

    Still needed: The department's own programme description or the Bureau for Behavioral Health's service terms, read directly. Pages read and found silent on funding and intake: https://veterans.wv.gov/Pages/Suicide-Prevention.aspx and https://veterans.wv.gov/GCP/Pages/default.aspx

  • What "economically disadvantaged veteran" means for the Military Incentive Credit

    high confidence it exists · W. Va. Code §21A-2C-1 et seq.

    The credit tiers are published and the certification requirement is clear, but the standard WorkForce applies when deciding whether a veteran is economically disadvantaged is not in the tax publication. It decides which of two very different credit amounts an employer can claim.

    Still needed: The certification procedure or rule, read from WorkForce's own material. workforcewv.org's recruit-and-hire page was read this session and does not carry it.

  • Lease termination, consumer contract cancellation, interest caps and deployed-parent custody protection

    high confidence it exists · W. Va. Code ch. 37, ch. 46A and ch. 48

    Every consumer and family-law protection for servicemembers in this state sits in the Code, and the Code host refused every connection again this session — as it has in each previous round. Nothing at all is established about residential lease termination on orders, cancelling a term consumer contract, an interest-rate cap below the federal 6 percent, or whether a deploying parent is protected in a custody proceeding.

    Still needed: W. Va. Code chapters 37, 46A and 48 read directly. code.wvlegislature.gov refused every connection on 23 August 2026. An alternative official route — the Legislature's bill text service or a Secretary of State publication reproducing the sections — would do.

  • Whether the telephone and broadband lifeline discount has a veterans pension route

    high confidence it exists · Public Service Commission Lifeline programme rules

    The published absence in this corpus covers the 20 percent reduced-rate utility programme and energy assistance, both read on the Bureau for Family Assistance's own page on 23 August 2026 and both silent on veterans. The Public Service Commission runs a separate telephone and broadband lifeline discount that was not read. In at least one other researched state a veterans or survivors pension is an express qualifying programme for the equivalent discount, so this is a live question rather than a formality.

    Still needed: The Commission's Lifeline programme page and its qualifying-programme list, read directly: https://www.psc.state.wv.us/LifeLine/ . Page read this session and found silent on veterans: https://bfa.wv.gov/utility-assistancelieap

  • Statutory authority for the department programmes published from agency pages

    high confidence it exists · W. Va. Code — chapter and article to be identified

    Four records were published on 23 August 2026 from the department's own pages at tier B because no statute could be read. The state code host refused everything: https://code.wvlegislature.gov/19-1-12/ and https://code.wvlegislature.gov/62-15-1/ both returned HTTP 403 to a plain fetch AND to a real browser session, and https://www.wvlegislature.gov/wvcode/ChapterEntire.cfm?chap=19&art=1&section=12 issues a 301 straight onto that host. The bill-text path https://www.wvlegislature.gov/Bill_Status/bills_text.cfm also returned 403.

    Still needed: Any reachable copy of the Code on a state host. Until then the women veterans programme, the nursing facilities, the RAFT programme and the benefits office network stay at tier B.

  • Whether a veterans treatment court operates, in which circuits, and on what terms

    medium confidence it exists · To be identified — W. Va. Code, treatment court article

    The judiciary publishes a treatment courts landing page that names adult, juvenile and family treatment courts and says the court system continues to add them. It does not mention veterans anywhere. Whether a veterans docket runs inside an adult treatment court, under what eligibility gate, and what completion earns, was not established.

    Still needed: The judiciary's adult treatment court pages and any statutory article creating a veterans docket. Read this session and silent on veterans: https://www.courtswv.gov/lower-courts/treatment-courts, read through a real browser because a plain fetch returns only the site chrome. The code host refused every request.

  • Transport to VA hospitals and clinics for veterans living at home

    medium confidence it exists · To be identified

    The only funded transport found anywhere in this state's pages this session reaches residents of the state nursing facility — two wheelchair-capable buses running to medical appointments, now published on that record. Nothing on the veterans department site, whose full site map was read, describes transport for a veteran living at home. The department site map has no transportation page at all.

    Still needed: A county or regional transit page, or a service organisation arrangement funded by the State. Read this session and silent: https://veterans.wv.gov/pages/site-map.aspx and https://veterans.wv.gov/benefits/Pages/StateBenefits.aspx.

  • The veteran designation on a driver licence or state ID — proof required and fee

    medium confidence it exists · To be identified — W. Va. Code tit. 17B

    The corpus carries the veteran licence plates but nothing about the designation printed on a driver licence or identification card, which is the cheaper and more widely useful of the two. The state benefits page published by the veterans department does not mention it either.

    Still needed: The motor vehicle division page setting out the proof required and any fee. transportation.wv.gov is mid-migration: https://transportation.wv.gov/dmv/Drivers/Pages/Veteran-Designation.aspx returns 404, and the division's own news item on the designation now resolves to a "Site Under Construction" 404 page.

  • Turnpike tolls — whether any veteran, Purple Heart or disabled veteran discount exists

    medium confidence it exists · Parkways Authority toll schedule; W. Va. Code ch. 17, art. 16A

    The state runs a major tolled turnpike and the corpus has nothing on it. Several states in this corpus exempt a Purple Heart or Medal of Honor plate from tolls, so the question is a real one rather than a formality, and a commuter crossing the toll barriers daily has a material amount of money riding on the answer.

    Still needed: The Parkways Authority toll rate schedule and any discount plan eligibility list. Tried 23 Aug 2026: wvturnpike.com returns 200 at the site root and at /e-zpass, but /toll-rates, /turnpike-information, /how-it-works and /customer-service all render the home page shell with no body content retrievable; code.wvlegislature.gov returned 403 again.

  • Veteran designation on a driver’s licence or state ID — proof, cost and where to apply

    high confidence it exists · Division of Motor Vehicles licensing guidance

    The Division used to publish a page telling veterans to bring a DD 214, other military identification, or a registration card showing a current military plate to a regional office. The Division has since migrated its website and the licensing pages read this session no longer mention veterans anywhere, so a benefit that plainly exists has no citable published source.

    Still needed: The current Division of Motor Vehicles page for the veteran designation on a licence or identification card. Tried 23 Aug 2026: dmv.wv.gov reads and its driver services and forms pages were read in full, but neither mentions the veteran designation; the former page at transportation.wv.gov/DMV/News/Pages/StateAgenciesRemindVeteransofDesignationonDriver’sLicenses.aspx now returns 404, as does the former military plates page at transportation.wv.gov/DMV/Vehicle-Services/License-Plates/Special-Plates/Pages/Military.aspx.

Nevada — 14 on the worklist

A first pass over Nevada statewide law: the tiered disabled veteran exemption, read from the statute with the Department of Taxation’s current-year figures. Geography is complete for all 17 counties; county tax rates and the local layer are not.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer is now OPEN for this state: the flagship metro transit fare is published. Remaining: every other transit authority, county and municipal programme (park passes, utility discounts, local tax add-ons) - the layer is a permanent workstream, not a single record.

    Still needed: The statute or the administering agency page, read directly.

  • State business licence fee waiver for veteran-owned businesses

    high confidence it exists · A.B. 274 (2025); NRS ch. 76

    A 2025 measure requires the Secretary of State to waive the state business licence issuance fee, and renewal fees for an opening period, where the applicant is an eligible veteran or a gold star family member, or the business is at least 51 percent owned by them. The definition of "eligible veteran" and the length of the renewal waiver both need reading from the administering agency.

    Still needed: The veterans department page https://veterans.nv.gov/business-license/ returned HTTP 404 this session and leg.state.nv.us returned HTTP 403 for the NRS chapters. Read the Secretary of State's own business licence pages, or the enrolled bill.

  • Gift Account for Veterans and any state emergency assistance paid from it

    medium confidence it exists · NRS ch. 417

    The department's donation page describes gifts funding emergency assistance, outreach, wellness programmes and the homes and cemeteries, which implies a standing account rather than an ad hoc one. Whether an individual veteran can apply to it, and on what terms, is unresolved — the department's financial pages read on 22 August 2026 list only federal and charitable help.

    Still needed: leg.state.nv.us returns HTTP 403 for the NRS. Read ch. 417 from another legislative source and pair it with the department's own account or application material. Pages read and found silent: https://veterans.nv.gov/benefits-and-services/financial/ and https://veterans.nv.gov/claims-and-assistance/financial-resources/

  • Bid preference for businesses owned by veterans with a service-connected disability

    high confidence it exists · NRS 338.13841 to 338.13847

    A 5 percent preference on public works construction bids below a stated threshold is referred to by state purchasing material, and a separate preference may exist in the general purchasing chapter. Neither the percentage, the threshold nor the certification route has been read from an administering page.

    Still needed: publicworks.nv.gov/Bids/Veteran_s_Preference/ returned an administrator rejection this session and veterans.nv.gov/employers/preference-to-veteran-owned-business/ returned HTTP 404. Read the purchasing division's own regulation, or the chapter from a legislative source.

  • The four higher education fee waivers — credit caps, duration and residency deeming

    high confidence it exists · NRS 396.544, 396.5442, 396.5443, 396.5445

    All four waivers are now published from the System of Higher Education's own page, read 23 August 2026 — Guard, Purple Heart, Guard survivors and POW/MIA families, with what is waived, the professional school exclusions and the ten-year survivor clocks. What the System page does NOT give is a credit-hour cap, a maximum duration, whether a recipient is deemed a resident for tuition purposes, or how a child of a Purple Heart recipient qualifies. Those decide how far each waiver actually goes.

    Still needed: The four NRS sections and Title 4, Chapter 17 of the Board of Regents Handbook, read directly. leg.state.nv.us refused connections for the NRS this session. Page read and published from: https://nshe.nevada.edu/system-administration/departments/asa/students/student-veterans/

  • Whether the Purple Heart waiver is available before other education benefits are exhausted

    high confidence it exists · NRS 396.5443

    Two state pages disagree. The veterans department describes the Purple Heart waiver as available "once they have exhausted all of their education benefit"; the System of Higher Education describes it plainly, with no sequencing condition. Both were read on 23 August 2026. A recipient with federal entitlement remaining is being told two different things about whether they can use the waiver now.

    Still needed: NRS 396.5443 and the Board of Regents Handbook chapter, read directly, or the System's own waiver form terms. Pages read: https://veterans.nv.gov/veteran-resources/education/ and https://nshe.nevada.edu/system-administration/departments/asa/students/student-veterans/

  • Any state-funded mental health or peer support programme that pays for care

    medium confidence it exists · To be identified (NRS ch. 417)

    The department's own suicide prevention page was read on 23 August 2026. Everything on it is either federal — the medical centres, the vet centres, the crisis line — or a third-party resource. The only state element named is collaboration with the state Office for Suicide Prevention on the Governor's Challenge, with no service, funding or intake route described. Either no state programme pays for veteran mental health care here, or the department does not publish it.

    Still needed: The Office for Suicide Prevention's own programme terms, and ch. 417 read directly. leg.state.nv.us refuses connections. Page read and found silent: https://veterans.nv.gov/health-wellness/suicide-prevention/

  • Whether NRS 417.133 caps or forbids fees for helping with a veterans benefits claim

    high confidence it exists · NRS 417.133

    The disclosure requirement at NRS 417.135 is now published from the department's own required form, read 23 August 2026, along with the $10,000 civil penalty at NRS 417.137 and the consumer fraud action under NRS 41.600. The form references NRS 417.133 as a companion provision carrying the same penalty, but does not say what 417.133 requires. If it caps or prohibits fees outright, that is a stronger protection than disclosure and belongs in the published record.

    Still needed: NRS 417.133 read directly. leg.state.nv.us refused every connection on 23 August 2026. Form read: https://veterans.nv.gov/wp-content/uploads/2025/07/NRS-417.135-Form.pdf

  • Five percent bidding preference for a disabled-veteran-owned business on public works

    high confidence it exists · NRS 338.13841 to 338.13847

    The state public works division publishes a veteran's preference and maintains a list of contractors holding it. The preference is described as 5 percent on public works projects under $100,000 for a business owned by a veteran with a service-connected disability. This state has no business record in the corpus at all, so it would open a category.

    Still needed: NRS 338.13841 to 338.13847, and the public works division's own preference page and certificate-of-eligibility process. publicworks.nv.gov rejected every request on 23 August 2026 with a firewall page, and leg.state.nv.us refused connections.

  • Whether the landlord and tenant chapter carries a military termination right

    medium confidence it exists · NRS ch. 118A

    Two neighbouring states in this research set have now had their landlord and tenant acts read end to end and published as carrying no military provision. The same question is open here and cannot be answered without the chapter text, which is behind a host that refuses connections.

    Still needed: NRS chapter 118A read directly from the Legislature. leg.state.nv.us refused every connection on 23 August 2026.

  • Statutory authority for the records published from agency pages

    high confidence it exists · NRS — chapters 176A, 333, 417

    Four records were published on 23 August 2026 at tier B because no statute could be read. leg.state.nv.us returned HTTP 403 to every plain request (tried: https://www.leg.state.nv.us/NRS/NRS-176A.html), and a real browser session was served a Cloudflare "Sorry, you have been blocked" interstitial that did not clear after an eight-second wait and a re-read.

    Still needed: Any reachable copy of the statutes on a state host. Until then the veterans courts, the women and minority veterans programme, the service officer network and the advocate course stay at tier B.

  • State purchasing preference for a local business owned by a veteran with a service-connected disability

    high confidence it exists · NRS 333.3366 to 333.3368

    This corpus carries no business record for this state at all, and a bid preference for a local business owned by a veteran with a service-connected disability appears to sit in the state purchasing chapter, along with a fraud provision and a duty to report to the Legislature on how the programme performs. The size of the preference and the application route are the whole value of the record and neither was established.

    Still needed: The section text, and the purchasing division page describing how a business applies. leg.state.nv.us is blocked as described above. purchasing.nv.gov was fetched this session and its home page carries no veteran content at all.

  • What each veterans court accepts, and what completion earns

    high confidence it exists · NRS 176A — specialty court provisions

    The judiciary directory is now published as a record: seven courts run a veterans docket and all seven are in two counties. What none of the judiciary pages state is the eligibility gate — which offences are accepted, whether combat service or a service-connected diagnosis is required — or whether completion earns dismissal, a sealed record or only a lighter sentence.

    Still needed: An individual court programme page for one of the seven, and the statutory provisions on specialty courts. Read this session and silent on all of it: https://nvcourts.gov/aoc/programs_and_services/specialty_courts/overview and https://nvcourts.gov/aoc/programs_and_services/specialty_courts/find-a-specialty-court.

  • Any agriculture programme with a veteran route

    low confidence it exists · To be identified

    The veterans department's full site was crawled this session — every page linked from its home page was listed — and nothing on it mentions agriculture, farming or ranching. The advocate certification syllabus includes an entrepreneurship module but no farming module.

    Still needed: The state agriculture department pages, which were not opened this session, and any beginning-farmer programme with a veteran preference.

New Mexico — 11 on the worklist

A first pass over New Mexico statewide law: both 2024 constitutional amendments — the $10,000 inflation-indexed veteran exemption and the disabled veteran exemption made proportional to the rating. Geography is complete for all 33 counties; county tax rates and the local layer are not.

  • Disabled parking placards and the veteran designation on a licence or ID

    high confidence it exists · NMSA §66-3-16 and the motor vehicle division rules

    Searches this session surfaced three motor vehicle division pages that would settle this topic outright: the veteran designation page for driver licences and IDs, the parking placards page, and the military and veterans licence plates page — the last of which appears to say that a 50 percent disabled veteran who also qualifies for the limited mobility plate may have the wheelchair symbol added with no fee for plate or registration. None could be read.

    Still needed: A readable copy of the administering agency's own pages. Tried this session and blocked: https://www.mvd.newmexico.gov/nm-drivers-licenses-ids/veteran-designation/, https://www.mvd.newmexico.gov/vehicles/parking-placards/ and https://www.mvd.newmexico.gov/vehicles/license-plates/military-and-veterans/ — every one returns a CloudFront 403 stating the distribution is configured to block access from this country, identically by direct fetch, by pinned curl with a browser user agent, and through a browser session. The legislature's own site is separately walled, and every court host redirects to a loopback address. This is a geographic block on the agency's content delivery network, not a rate limit, so retrying will not help; it needs a request from a permitted region.

  • Motor vehicle excise tax exemption for limb loss

    high confidence it exists · To be identified

    DVS lists an excise exemption for loss or complete loss of use of limbs, and two-thirds registration rates besides — both need the statute read.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. New Mexico has 33 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State emergency or hardship financial assistance for veterans

    medium confidence it exists · To be identified (NMSA ch. 28)

    The department's own state benefits page was read in full on 22 August 2026 and carries property tax, scholarships, plates, recreation, hunting and fishing, employment preference and procurement — but no emergency or hardship fund. Whether the state benefits fund the department administers can pay an individual in crisis is unresolved.

    Still needed: Read the veterans chapter of the statutes and ask the State Benefits Office directly. Page read and found silent: https://www.dvs.nm.gov/benefits/

  • State veterans cemetery eligibility rules and fees

    high confidence it exists · To be identified

    The cemetery programme is published and its record carries no cost figure, because neither the programme page nor the burial pre-application form states a plot fee, a family fee or a residency test. The page and the form also list different sets of locations.

    Still needed: The cemetery programme rules, read from the department. Pages read and found silent on fees: https://www.dvs.nm.gov/cemetery/ and the pre-application form.

  • NMSA sections behind the deployment custody bar, the discharge confidentiality rule and the hiring credit

    high confidence it exists · NMSA 1978 (sections to be identified)

    Three records were published on 23 August 2026 from the veterans department's own state benefits page: that custody cannot be modified while a parent is deployed, that a discharge filed with a county clerk is restricted to three named persons, and that a business may claim up to $1,000 for hiring a recently returned veteran. The department publishes no citation for any of them, and a court or an accountant will want one.

    Still needed: NMSA 1978 read directly. www.nmlegis.gov returned HTTP 403 on 23 August 2026 and nmonesource.com returned 403 as well. Page read: https://www.dvs.nm.gov/benefits/

  • What "recently returned" means for the $1,000 veteran hiring credit

    high confidence it exists · NMSA 1978 ch. 7 (income and gross receipts tax credits)

    The credit is now published from the veterans department's page, read 23 August 2026, at up to $1,000 for each hire of a recently returned veteran. The page does not define the separation window, does not say whether a minimum period or number of hours of employment applies, and does not say whether the credit is refundable or carried forward. Those are the first three questions an employer asks.

    Still needed: The Taxation and Revenue Department's own credit page and claim form, and the NMSA section. nmlegis.gov returned 403 on 23 August 2026.

  • Veterans treatment courts — which districts run one, the gate, and what completion earns

    high confidence it exists · To be identified

    A metropolitan court veterans programme and a statewide therapeutic justice programme both appear to exist, and this corpus carries nothing on either. Which courts run a veterans docket, what offences are accepted, whether a veteran mentor is assigned, and what completion earns are all unresolved.

    Still needed: Any nmcourts.gov page, read directly. Every nmcourts.gov host tried this session answered HTTP 302 with a Location header of http://127.0.0.1/ — a bot defence that a plain fetch cannot follow and that a browser session was refused outright (https://metro.nmcourts.gov/services-programs/community-veterans-court/ and https://treatmentcourts.nmcourts.gov/services-programs/treatment-court-types/). The statute host www.nmlegis.gov answered 403.

  • Statutory footing for the transport, women veterans and healthcare programmes

    medium confidence it exists · NMSA 1978, ch. 9, art. 22 (Department of Veterans Services Act) and related

    Four records were published on 23 August 2026 at tier B from the department's own pages. Whether the transport programme, the women veterans programme or the healthcare coordination division has any statutory floor — as opposed to being an administrative arrangement that a future secretary could end — was not established, and it matters most for the state-funded half of the transport programme.

    Still needed: The statutes, read directly. www.nmlegis.gov returned HTTP 403 to every request this session. nmonesource.com answered 200 but renders its statute navigation entirely in script, so no section could be reached by fetch; it is worth a browser session next time.

  • Whether a caregiver may ride, and what the transport programme will not do

    high confidence it exists · Department of Veterans Services programme policy

    The transport programme is now published: free round trips, thirty-three counties, three days' notice, VHIC/VIC or a government ID with a veterans designation. What the page does not say is whether a caregiver or escort may travel, whether there is a mileage or distance limit, what happens when an appointment overruns the driver's day, and whether a surviving spouse attending a VA appointment is carried.

    Still needed: The programme's own rider policy or rules, or an answer from the transportation coordinator. Page read this session: https://www.dvs.nm.gov/rural-veterans-transportation-program/

  • Any state agriculture programme with a veteran route

    low confidence it exists · To be identified

    The veterans department's whole site was crawled this session and nothing on it mentions agriculture, farming or ranching. The veteran farmer training that surfaced is run by national nonprofits and federal programmes, not by the State.

    Still needed: The state agriculture department pages, and any beginning-farmer or land-link programme with a veteran preference, read directly.

Oregon — 16 on the worklist

A first pass over Oregon statewide law: the disabled veteran exemption with its statutory 3% annual escalator, read from the statute. Geography is complete for all 36 counties; county tax rates and the local layer are not.

  • Veteran home loan — residency, time-after-discharge and Guard service

    high confidence it exists · ORS 407

    The loan itself is now published from the department's own pages, read 23 August 2026: fixed-rate purchase financing, owner-occupied single family, up to the Fannie Mae limit, four loans as a lifetime maximum, no refinancing. What those pages do NOT state is whether the borrower must be an Oregon resident, whether there is a time limit after discharge, or how Guard and Reserve service is counted. Three questions a borrower has to answer before applying, and the eligibility page answers none of them.

    Still needed: ORS chapter 407 and the department's lending rules, read directly. Pages read and found silent on all three: https://www.oregon.gov/odva/Home-Loans/Pages/default.aspx and https://www.oregon.gov/odva/Home-Loans/Pages/Eligibility.aspx

  • National Guard tuition assistance — whether fees and books return after 2025-26

    high confidence it exists · To be identified (ORS 348)

    The student aid agency states that for 2025-26, due to budgetary considerations, awards are based on tuition costs only and fee costs and book allowances will not be covered. The published record carries that restriction, but nothing read establishes whether it is a one-year measure or the new baseline. A member planning a multi-year degree needs to know which.

    Still needed: The agency's award notice for the following year, or the statute and administrative rule behind the programme. Page read: https://oregonstudentaid.gov/grants/oregon-national-guard-state-tuition-assistance/

  • Hunting, fishing and state park concessions

    high confidence it exists · To be identified

    Thresholds ranged from any-degree to 100% across researched states.

    Still needed: The statute or the administering agency page, read directly.

  • Disabled veteran plates and registration

    high confidence it exists · To be identified

    Plate-by-plate reading needed.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer is now OPEN for this state: the flagship metro transit fare is published. Remaining: every other transit authority, county and municipal programme (park passes, utility discounts, local tax add-ons) - the layer is a permanent workstream, not a single record.

    Still needed: The statute or the administering agency page, read directly.

  • Temporary licensure and fee treatment for military spouses across licensing boards

    high confidence it exists · ORS ch. 670; board-level administrative rules

    Individual boards publish their own military spouse temporary permit rules, which suggests a general framework above them. Whether there is a single statute setting terms and fees, and what those terms are, is unresolved.

    Still needed: oregonlegislature.gov refused the connection this session. Read ORS chapter 670 from a legislative source and pair it with a board-level rule.

  • What the emergency financial assistance grant actually pays

    high confidence it exists · OAR ch. 575

    The grant is published and now recorded, but the agency states only that average award amounts vary. No cap, no income threshold and no asset test appears on either agency page. The administrative rules behind the programme would settle all three.

    Still needed: Read OAR chapter 575 division 30, and the VS1024 application form itself, directly.

  • Disabled veteran plates and the permanent registration fee

    high confidence it exists · ORS 805.100

    The veterans agency describes branch, campaign, permanent disabled veteran, Gold Star Family and Purple Heart plates, and refers to a one-time permanent registration fee for disabled veterans, but publishes no amount, no plate limit and no eligibility detail beyond the statutory cross-reference.

    Still needed: The motor vehicle services fee schedule and plate eligibility pages, read directly, paired with ORS 805.100. Page read and found short of figures: https://www.oregon.gov/odva/benefits/pages/licenses.aspx

  • Termination of a tenancy on armed forces orders — the notice, the effective date and the penalty bar

    high confidence it exists · ORS 90.475

    A statute of this number and subject appears to exist and would be a strong housing record: a tenant giving written notice with proof of orders, an effective date tied to federal law or a fixed period before the orders take effect, and no penalty, fee, charge or loss of deposit. None of it can be published, because the statute text was not read — only search summaries describing it, which the doctrine does not accept.

    Still needed: ORS 90.475 read directly. www.oregonlegislature.gov refused every connection on 23 August 2026 (ECONNREFUSED), including https://www.oregonlegislature.gov/bills_laws/ors/ors090.html and the ORS index page.

  • Whether the home energy assistance programme has a veteran preference or supplement

    medium confidence it exists · Oregon Housing and Community Services LIHEAP state plan

    The telephone and broadband discount is now published with its veterans pension route, read 23 August 2026 on the Public Utility Commission's own page. The separate home heating assistance programme was not read, and at least one other researched state adds a flat dollar supplement for a household containing a veteran.

    Still needed: The state LIHEAP plan and the Housing and Community Services energy assistance eligibility page, read directly.

  • ORS text for the agency programmes published from department pages

    high confidence it exists · ORS ch. 406 and 408

    Four records were published on 23 August 2026 at tier B because no ORS text could be read. https://www.oregonlegislature.gov/bills_laws/ors/ors137.html timed out after thirty seconds on a plain fetch, and a real browser session was refused navigation to the host entirely. The department itself cites ORS 406.530 and OAR 274-037-0400 on its grant pages, so the sections exist and are citable once the host is reachable.

    Still needed: Any reachable copy of the statutes on a state host. Until then the justice-involved record, the conservatorship programme, the aging services division and the service office network stay at tier B.

  • What the state charges to act as conservator or representative payee

    high confidence it exists · ORS ch. 406; department fee schedule

    The conservatorship programme is now published: running since 1965, professional fiduciary management of income and assets for veterans the federal department has found incompetent, extending to buying and selling real estate. The single fact that decides whether a family uses it — the fee — is not on the page.

    Still needed: The department fee schedule or the administrative rule setting it. Page read this session: https://www.oregon.gov/odva/agency-programs/avs/Pages/default.aspx

  • Which counties operate a veterans docket, and on what terms

    high confidence it exists · To be identified

    The department states there is no entitlement — diversion turns on a district attorney deciding case by case, weighing the seriousness of the offence and the victim, and possibly weighing garrison service against combat deployments. That is now published. Which counties actually run a docket, and what completion earns in each, is not.

    Still needed: A district attorney or circuit court page for a county that runs one. Read this session and silent on the county list: https://www.oregon.gov/odva/Resources/Pages/Justice-Involved-Veterans.aspx

  • Whether any state farm-finance programme has a veteran route

    medium confidence it exists · ORS 285A.420 to 285A.435; OAR 123-052

    The state runs a beginning and expanding farmer loan programme through bond financing, cited by the economic development agency to ORS 285A.420 to 285A.435 and OAR 123-052. Its programme page names no veteran preference and no veteran route. Whether the statute or the rule creates one, or whether the veterans department lends against farmland under its own home loan programme, was not established.

    Still needed: The cited sections and rule, read directly, and the veterans department home loan terms on farmland. Page read this session and silent on veterans: https://www.oregon.gov/biz/programs/aggiebond/pages/default.aspx. The statute host was unreachable.

  • Whether any toll, bridge or ferry fee relief exists for a disabled veteran or Purple Heart plate

    medium confidence it exists · ORS ch. 383 (tollways); Transportation Commission policy

    Nothing on tolls or ferry fares has been read for this state. The veterans department's own licence plate page, read 23 August 2026, mentions no toll relief, and the motor vehicle fee chapter read the same day is silent on it.

    Still needed: The transportation department's own tolling programme page, and the ORS tollway chapter, read directly. The legislature's own site refused every connection on 23 August 2026.

  • State-funded caregiver support, respite or adult day care with a veteran route

    medium confidence it exists · To be identified — Department of Human Services aging and people with disabilities

    The veterans department's long-term care page was read on 23 August 2026 and covers conservatorship, representative payee services, the state veterans homes and federal VA care for aging veterans. It names no respite, adult day health, in-home care or veteran-directed care programme. The aging veteran services record already in this corpus does not carry those either.

    Still needed: The human services department's own aging and disability pages naming a veteran route, read directly.

Utah — 20 on the worklist

A first pass over Utah statewide law: the proportional armed forces exemption, read from the Tax Commission’s Publication 36. Geography is complete for all 29 counties; county tax rates and the local layer are not.

  • Military retirement tax credit

    high confidence it exists · Utah Code §59-10-1042

    Utah runs a nonrefundable credit for military retirement pay (2021 SB 11). The credit arithmetic needs reading before figures are published.

    Still needed: The statute or the administering agency page, read directly.

  • Veterans preference in state employment

    high confidence it exists · Utah Code §71A-10

    Utah runs preference in public hiring; mechanics need reading.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    Transit fares, park passes and utility discounts turned out to be real and highly variable wherever we researched them. Utah has 29 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Professional licence fee waiver, deployment extension and military spouse practice

    high confidence it exists · Utah Code §58-1-308

    Utah waives initial and renewal licence fees for qualifying military service members, automatically extends a licence that expires during deployment, and lets a military spouse with an active out-of-state licence practise here without a Utah licence. The size and conditions of each need reading from the regulator or the code.

    Still needed: Every host carrying it refused this session: dopl.utah.gov/military-resources/, commerce.utah.gov/dopl/military-resources/ and oplr.utah.gov/military-resources all returned HTTP 403, and le.utah.gov/xcode/Title58/Chapter1/58-1-S308.html refused the connection outright. Re-try from a different network.

  • Veteran-owned business — registry, certification or preference

    medium confidence it exists · To be identified

    The veterans department runs a Veteran-Owned Business Registry that any level of veteran ownership can join, but the registry page describes it as a way for the public to find veteran businesses — not as a certification and not as a procurement preference. Whether a state contracting preference exists at all is unresolved.

    Still needed: The state procurement code and the Division of Purchasing read directly, to establish whether any preference exists behind the registry.

  • State emergency or hardship financial assistance for veterans

    medium confidence it exists · To be identified

    The department's own 2026 benefit book was read cover to cover on 22 August 2026. It has no state emergency or hardship fund in it. The only hardship resource it lists is a transitional housing charity in Ogden. Either no state fund exists, or the department does not publish it in its main guide.

    Still needed: Ask the department directly, and read the veterans title of the state code. Source read and found silent: https://veterans.utah.gov/wp-content/uploads/2026/04/benefitBook_2026.pdf

  • Veterans preference — the statute itself, and who beyond the state is bound

    high confidence it exists · Utah Code 71A-2-101 and 71A-2-102

    The preference is now published from the state human resource division's own hiring page, read 23 August 2026: five points or five percent, ten with a disability at any percentage or a Purple Heart, and the same percentage for a spouse or surviving spouse. What the division's page does NOT settle is which employers beyond the state are bound — the department's benefit book mentions local governments and some private employers — or what a veteran can do when an agency does not apply the points.

    Still needed: The two sections read directly. le.utah.gov refused every connection this session (ECONNREFUSED), including the chapter PDF. Page read and published from: https://dhrm.utah.gov/hiring-pathways/veterans

  • Guard State Tuition Waiver — the statutory set-aside and how awards are rationed

    medium confidence it exists · Utah Code title 53B chapter 8

    The waiver and the separate $7,000 state tuition assistance programme are now published from the Guard's own application form and State Operations Policy 26-01, read 23 August 2026. Neither document says how many waivers exist, whether a statutory percentage of institutional waivers is reserved for Guard members, or what happens when applications exceed the supply — which matters because the packet includes an essay and transcripts, suggesting selection rather than entitlement.

    Still needed: The tuition waiver chapter read directly, and the Guard education office's award statistics. Documents read: https://guard.utah.gov/wp-content/uploads/STW_Application-25-26-School-year.pdf and https://guard.utah.gov/wp-content/uploads/SOA-FY2026-UTNG-State-Education-Benefits-SFY26.pdf

  • Free or reduced vital records for a veteran benefit claim

    low confidence it exists · To be identified

    Several states in this corpus waive the fee for a birth, death or marriage certificate needed for a claim to the federal department. Nothing of the kind appears on the state veterans department's own pages read this session, and the Code host refused every connection, so neither the presence nor the absence of such a waiver could be established.

    Still needed: The vital records office's own fee schedule and any exemption list, read directly, and the Code section on vital record fees.

  • Any state contracting or procurement preference for veteran-owned firms

    medium confidence it exists · To be identified

    The 2026 benefit book's business section lists a state-created advisory centre and then only federal resources. No bid preference, set-aside or certification appears. Most states in this corpus have one, so its absence here is worth confirming rather than assuming.

    Still needed: Read the procurement code, and the state purchasing division's own vendor pages.

  • Whether the home energy assistance programme has a veteran preference or supplement

    high confidence it exists · Utah Code ch. 35A-8; state LIHEAP plan

    Two utilities records exist corpus-wide and this state has none. The energy assistance programme's priority groups are described in secondary summaries as disability, age sixty and over, and young children, with no veteran route — but the programme's own pages could not be read, so no absence can honestly be published either.

    Still needed: jobs.utah.gov/housing/scso/seal/heat.html and the HEAT policy manual at jobs.utah.gov/housing/scso/seal/documents/heatpolicymanual.pdf both returned HTTP 403 on 23 August 2026. psc.utah.gov's HEAT page carries only a link out. The programme page or the policy manual, read directly, would settle it.

  • Utah Code sections behind the active-duty property tax exemption and the Utah@EASE programme

    high confidence it exists · Utah Code ch. 59-2 (Property Tax Act); Title 39A

    The 200-day active-duty exemption equal to the total taxable value of a primary residence is published from the veterans department's 2026 resource guide, read 23 August 2026. The guide gives no section number, and the day-counting rule, the treatment of Guard service under state orders and what happens if the member is deployed on the 1 September deadline all depend on the text. Utah@EASE likewise has no published statutory basis.

    Still needed: Utah Code chapter 59-2 and Title 39A read directly. le.utah.gov refused every connection on 23 August 2026 (ECONNREFUSED), including https://le.utah.gov/xcode/Title39A/Chapter5/39A-5.html .

  • The lifetime Veterans Honor Pass, and what works as entry until it launches

    high confidence it exists · Division of State Parks policy; Department of Veterans and Military Affairs

    The department benefits booklet revised in 2026, read 23 August 2026, states that in partnership with the federal department a LIFETIME Veterans Honor Pass is being prepared and is pending final federal approval, and that until the official rollout a veteran should continue to use the 2025 Veterans with Disabilities Honor Pass together with a VA summary of benefits letter showing state residency or ANY disability rating — adding that the benefits letter will remain a valid entry method even after the new pass launches. The honour pass record already in this corpus does not carry the transition, the ANY-rating wording, or the fact that a letter alone gets you in.

    Still needed: The state parks page setting out the current pass terms, and confirmation of whether the lifetime pass has launched. Booklet read this session: https://veterans.utah.gov/wp-content/uploads/2026/08/Utah-Department-of-Veterans-Military-Affairs-Benefit-Booklet.pdf

  • Veterans courts — which districts run one, the gate, and what completion earns

    high confidence it exists · To be identified — Utah Code tit. 78A

    Nothing in this corpus covers the criminal justice route, and the department benefits booklet read this session does not mention a veterans court at all. Which judicial districts operate one, whether a justice court runs a separate programme, the eligibility gate and the consequence of completion are all unresolved.

    Still needed: A judiciary page, read directly. https://www.utcourts.gov/en/about/court-programs/specialty-courts.html rendered only site chrome to a fetch and its subpages answered HTTP 406; a browser session on that host produced a not-found page, and the legacy court host refused navigation outright. le.utah.gov timed out after thirty seconds on a plain fetch and refused a browser session.

  • Statutory text for the benefits published from the department booklet

    high confidence it exists · Utah Code tit. 71A

    Three records were published on 23 August 2026 at tier B from the department benefits booklet because no statute could be read. le.utah.gov timed out after thirty seconds on a plain fetch and a browser session to that host was denied.

    Still needed: Any reachable copy of the state code. Until then the honour plate, the veterans information system and the claims assistance record stay at tier B.

  • Any state or county funded transport to VA hospitals and clinics

    medium confidence it exists · To be identified

    The department benefits booklet, revised in 2026 and read end to end this session, lists a medical centre, seven community clinics and four vet centres by address — and says nothing at all about how a veteran without a car reaches any of them. The department site has no transportation page: https://veterans.utah.gov/transportation/ returns 404.

    Still needed: A federal transportation service page for the state medical centre, or a county or transit page describing a veteran fare or ride programme. Booklet read this session: https://veterans.utah.gov/wp-content/uploads/2026/08/Utah-Department-of-Veterans-Military-Affairs-Benefit-Booklet.pdf

  • Whether the state runs a women veterans programme or coordinator post

    medium confidence it exists · To be identified

    The department benefits booklet was read end to end this session and the word "women" appears only in the description of military sexual trauma counselling at federal vet centres. https://veterans.utah.gov/women-veterans/ returns 404. If a women veterans programme exists here it is not published where a veteran would look for it.

    Still needed: The department's own pages or an organisational chart naming a women veterans coordinator, read directly.

  • Any state agriculture programme with a veteran route

    low confidence it exists · To be identified

    The department's business resources page and its 2026 benefits booklet were both read this session. Between them they name a micro loan fund, a small business finance nonprofit, a volunteer mentoring body and three federal routes — and no agriculture programme of any kind.

    Still needed: The state agriculture department pages, and any beginning-farmer or land-link programme with a veteran preference, read directly.

  • Whether the state energy assistance programme has a veteran route or veteran income treatment

    medium confidence it exists · To be identified — Department of Workforce Services home energy assistance

    This state has no utilities record. The veterans department's benefits and services index and its 2026 resource guide were both read in full on 23 August 2026 and neither mentions utilities, energy assistance or weatherisation at all.

    Still needed: The workforce services department's own home energy assistance pages and its income rules, read directly.

  • State-funded caregiver support or respite with a veteran route

    medium confidence it exists · To be identified — Division of Aging and Adult Services

    The veterans department's 2026 resource guide was read end to end on 23 August 2026. It contains no caregiver or respite section; the only long-term care it describes is the four state veterans nursing homes. Whether the aging division runs a caregiver programme that a veteran or a Gold Star parent can reach is unresolved.

    Still needed: The aging and adult services division's own caregiver support pages, read directly.

Alabama — 13 on the worklist

A first pass over Alabama statewide law: the H-3 total homestead exemption, read from the Department of Revenue — a general disability law a 100% permanent and total veteran qualifies under. Geography is complete for all 67 counties; county tax rates and the local layer are not.

  • Veterans preference in public employment

    high confidence it exists · To be identified

    Every mature state in this corpus operates one; the mechanics differ.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Alabama has 67 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Military Family Relief Fund — whether it ever pays an individual

    medium confidence it exists · Ala. Code §35-10-71

    The state veterans agency's own May 2025 compilation of the law was read on 22 August 2026. The Military Family Relief Fund appears there only as the destination for civil penalties under a foreclosure-protection law, with the agency permitted to use it to assist military families. No eligibility test, no grant amount, no application and no cap is stated anywhere in the compilation. It is not, on that evidence, a programme a veteran can apply to.

    Still needed: The agency's own fund policy or application, if one exists, and the statute itself. Source read and found silent on terms: the May 2025 compilation at va.alabama.gov.

  • Alabama State Veterans Memorial Cemetery — what the family is charged

    high confidence it exists · Ala. Code §31-5-3(d)

    The cemetery is now published from the agency's own burial page, read 23 August 2026 — state staffing and funding, over 120 acres, 5,000 graves, four interment types, pre-registration for the veteran and spouse. What that page still does NOT give is a fee schedule, a residency test, or a written eligibility rule. Several states in this corpus charge a spouse or dependant several hundred dollars for the same interment, so the missing figure is the one a family most needs.

    Still needed: The cemetery's own fee schedule and eligibility rule, read directly, and Ala. Code §31-5-3. Page read and published from: https://va.alabama.gov/veterans-services/burial-memorial-benefits/

  • Guard educational assistance — the per-term award figures

    high confidence it exists · Ala. Code §31-10-1 et seq.; Ala. Admin. Code 300-4-4

    The programme is now published from the Commission on Higher Education's own page and the administrative code chapter, read 23 August 2026 — need-based, tuition and educational fees at an Alabama public institution, a $100 cost-less-aid floor, a four-year separation clawback. The commission prints a per-semester and per-quarter award figure on its application form, but the numerals did not survive extraction from that file, so no amount could be published.

    Still needed: The current application form read in a form where the figures render, or the commission's award schedule. Files read: https://www.ache.edu/wp-content/Grants/ANGEAP-Appl-2025-2026.pdf and https://admincode.legislature.state.al.us/api/chapter/300-4-4

  • Free or reduced vital records for a veteran benefit claim

    low confidence it exists · To be identified

    The agency's military records page routes a veteran to the federal National Personnel Records Center for a free copy of a service record, which is a federal service and not a state benefit. Nothing on the agency's own pages addresses the fee for a state birth, death or marriage certificate needed for a claim, so no state waiver could be established either way.

    Still needed: The state public health department's vital records fee schedule and exemption list, read directly. Page read and found silent: https://va.alabama.gov/veterans-services/military-records-request/

  • State emergency or hardship financial assistance for veterans

    medium confidence it exists · To be identified

    Nothing in the agency's own compilation of state law creates an emergency grant for rent, utilities, food, medical or transport costs. A separate grant programme announced by the agency appears to fund organisations rather than individuals.

    Still needed: The agency's grant programme terms, read directly, and confirmation of whether any individual assistance route exists.

  • Ala. Code sections behind the deployment-death foreclosure stay and the sealed discharge record

    high confidence it exists · Ala. Code §35-10-71; §31-1-1; §8-8-6(a); §26-9-12; §9-14-8; §31-1-7

    Six records were published on 23 August 2026 from the veterans department's own Laws Affecting Veterans compilation, which quotes each rule and cites its section. The sections themselves were not opened. For the foreclosure stay in particular the text matters: whether the 180 days also halts interest, late fees or a declared acceleration, and whether a deployment that was not overseas counts, cannot be answered from a summary.

    Still needed: Ala. Code §35-10-71 and §31-1-1 read directly at https://alison.legislature.state.al.us/code-of-alabama?section=35-10-71 and ?section=31-1-1 . That host was reachable on 23 August 2026 but the sections were not opened this session. Compilation read: https://va.alabama.gov/wp-content/uploads/2026/03/AL-Laws-Affecting-Veterans-Act-2025-37-Draft.pdf

  • Any state lease or consumer contract termination right on military orders

    medium confidence it exists · Ala. Code ch. 35-9A (Uniform Residential Landlord and Tenant Act)

    The veterans department's own compilation of laws affecting veterans, read in full on 23 August 2026, contains no lease-termination or contract-cancellation entry — the closest thing in it is §8-8-6(a), which removes the usury cap from credit under federal veterans legislation rather than protecting a tenant. That is suggestive of an absence but not proof of one, because the compilation is a selection rather than the code.

    Still needed: Ala. Code chapter 35-9A read end to end at https://alison.legislature.state.al.us/code-of-alabama , which was reachable on 23 August 2026. Only a full read of the chapter can support a published absence.

  • The department compilation of every law affecting veterans

    high confidence it exists · Ala. Code, as compiled by the Department of Veterans Affairs (Act 2025-37 draft)

    The department publishes a compilation of the laws affecting veterans at https://va.alabama.gov/wp-content/uploads/2026/03/AL-Laws-Affecting-Veterans-Act-2025-37-Draft.pdf. Its table of contents alone names fishing and hunting licence concessions with several sub-classes, occupational licensure for military service, pistol permits for retired military personnel, teaching certificates, the driver licence and identification card, homes of totally disabled persons and those over 65, homes of veterans widows acquired under Public Law 814, the military combat pay income tax exemption, the military retiree income tax exemption, motor vehicle aid on a federal grant, access to National Guard facilities, attestation and acknowledgement certification, commitment of incompetent veterans, and exemption of debts incurred under the National Housing Act. Several of those are not in this corpus at all.

    Still needed: A readable copy. The PDF downloads at HTTP 200 and 636 KB but defeats extraction: its fonts are subsetted with no ToUnicode CMap and only a (1,0) format-6 cmap, so the extracted text is a substitution cipher rather than words. Try a copy with proper text encoding, or the code sections individually from a reachable host.

  • Veterans treatment courts — the statutory gate and which courts run one

    high confidence it exists · Ala. Code tit. 12, ch. 23A; Ala. Code §15-27-2

    Nothing in this corpus covers the criminal justice route for this state. The pieces that need reading are the accountability court chapter, which appears to cover offenders with a condition related to a veteran's mental illness or substance abuse and to require the consent of the district attorney and the court under a written agreement, and the expungement provision, which appears to reach charges dismissed after successful completion of a veterans court a year after completion. Neither was read from a primary source this session.

    Still needed: The sections themselves, and a judiciary or district attorney page naming the courts that operate a veterans docket. The department compilation that would carry the sections could not be extracted (see the candidate above).

  • Transport to VA hospitals and clinics

    medium confidence it exists · To be identified

    The department's whole site map was read this session and there is no transportation page on it. The service office network covers 62 counties for claims work; nothing published says anything about getting a veteran to a medical appointment.

    Still needed: A county veterans service office page or a state transit programme describing a funded ride or mileage payment. Read this session and silent: https://va.alabama.gov/site-map and https://va.alabama.gov/service-officer.

  • Any state agriculture programme with a veteran route

    low confidence it exists · To be identified

    The veterans department site map was read end to end this session and names no agriculture, farming or ranching programme. Whether the state agriculture department runs a veteran producer label or a beginning-farmer route with a veteran preference was not established.

    Still needed: The state agriculture and industries department pages, read directly.

Alaska — 13 on the worklist

A first pass over Alaska statewide law: the mandatory $150,000 exemption under AS 29.45.030(e). Geography is complete for all 30 boroughs and census areas; borough tax rates and the local layer are not.

  • State income tax treatment of military retirement

    high confidence it exists · To be identified

    How Alaska taxes military retirement decides real money and is unread here — published only once the statute or revenue department page is read.

    Still needed: The statute or the administering agency page, read directly.

  • Disabled veteran plates and registration

    high confidence it exists · To be identified

    Plate fee treatment differs plate-by-plate within a single state.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Alaska has 30 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State emergency or financial assistance for veterans

    medium confidence it exists · To be identified

    Read this session: the Office of Veterans Affairs Awards & Grants page lists exactly three items — the Governors Advocacy Award, an Endowment Fund and the Aleutian Campaign Acknowledgement — and describes none of them. None is presented as emergency relief, and no other state relief fund surfaced. That is a hint of absence, not proof, because the page is a directory with no substance behind the three names.

    Still needed: The three individual programme pages, or a departmental statement that no emergency assistance fund exists.

  • The Salcha cemetery — eligibility, fees and an opening date

    high confidence it exists · To be identified

    Half answered this session, and the answered half is now published as an absence. The office's own Interior of Alaska Veterans Cemetery page was read and states it is a State of Alaska veterans cemetery currently scheduled for construction at Salcha, administered through the Department of Military and Veterans Affairs. What that page does NOT state is who will be eligible, what any interment will cost, how the project is funded or when it opens; it refers readers to a transportation department public information portal for construction status instead. The office's burial pages still describe federal entitlements only.

    Still needed: A departmental page or project document giving the cemetery’s eligibility rules, fee schedule and opening date.

  • Free certified copies of a veteran's death certificate

    high confidence it exists · AS 18.50.320

    Search-level material this session says the bureau of vital statistics issues up to four certified copies of a veteran's death certificate without charge to a qualified person — a personal representative, a trustee, or someone who needs the copy to satisfy an eligibility requirement for a death-related benefit — and that the definition reaches the Territorial Guard, the Scouts and the Naval Militia. None of that was read from a primary source. The statute host refused (https://www.akleg.gov/basis/statutes.asp returned 403) and the health department host refused (https://health.alaska.gov/en/services/vital-records-orders/ returned 403). Nothing is published on a secondary source.

    Still needed: AS 18.50.320 read in full, or the bureau of vital statistics ordering page, giving the number of free copies, the qualified-person list and the veteran definition.

  • The fee for the Guard and Reserves hunting and fishing licence

    high confidence it exists · To be identified

    The Guard and Reserves resident licence is published this session from the Office of Veterans Affairs page, which calls it an annual licence carrying a fee and names no figure. The fish and game department's own licence index (https://www.adfg.alaska.gov/index.cfm?adfg=license.main) did not return military pricing, and https://www.adfg.alaska.gov/index.cfm?adfg=licenses.military returned 404.

    Still needed: The fish and game licence and tag price table, showing the military and Guard licence line.

  • Veteran and disabled veteran licence plate fees

    high confidence it exists · To be identified

    The motor vehicles division's veteran licence plate page, read this session, lists more than sixty unit designators available on a personalised plate but publishes no plate fee, no disability threshold and no fee waiver. Search-level material claims disabled veteran plates are free at a 50% rating; that was not read on the division's own page and is not published here.

    Still needed: The division’s plate fee schedule or its disability plates page, stating the threshold and whether the fee is waived.

  • State consumer and legal protections beyond the federal civil relief act

    medium confidence it exists · AS 34.03 (landlord and tenant); AS 25 (domestic relations)

    Nothing on residential lease termination for deployment or a change of station, a contract cancellation right, an interest cap below the federal six per cent, or deployed-parent custody appears anywhere on the state veterans office pages, which were read in full this session across burial, survivor, land, tax, employment, licensing and recreation. The statute host refused: www.akleg.gov returned 403 to every attempt. Silence on an agency benefits page is not absence of law, so nothing is asserted.

    Still needed: The Alaska Statutes on landlord and tenant, and on custody, read directly from a host that will serve them.

  • Whether any utility or heating programme has a veteran route

    low confidence it exists · To be identified

    No veteran discount, lifeline supplement or veteran preference inside a heating assistance programme appears on the veterans office additional-benefits index, which lists only burial and survivor, medical and disability, licences and plates, hunting and fishing, recreation, taxes and land, and employment. The commerce and regulatory commission hosts were not reached this session.

    Still needed: A regulatory commission tariff or a heating assistance programme page naming veterans, read directly.

  • The Anchorage Veterans Court — eligibility, phases and what completion earns

    high confidence it exists · To be identified

    The court exists and publishes a brochure (public.courts.alaska.gov/web/forms/docs/pub-121.pdf) plus an annual report lodged with the legislature. Every host refused this session: https://courts.alaska.gov/tc/index.htm returned ECONNREFUSED to the fetch tool, https://public.courts.alaska.gov and https://courts.alaska.gov were both denied navigation in the browser, and https://www.akleg.gov/basis/get_documents.asp is behind the same refusal wall that has blocked the statutes all round. Search-level material describes a VA-benefit-eligibility gate, a treatment-need test, a medium-to-high risk assessment on the Level of Service Inventory Revised, and disqualification for a prior felony under AS 11.41 — none of it read from the court, so none of it published.

    Still needed: The court system brochure pub-121 or the therapeutic courts directory, read directly, giving eligibility, phases, programme length and what completion earns.

  • A state women veterans coordinator

    medium confidence it exists · To be identified

    Read this session: the Office of Veterans Affairs benefits index, resources page and additional-benefits page carry no women veterans page and name no coordinator. A national association of state women veteran coordinators lists a named coordinator for this state with a departmental telephone number, but that is a secondary source and was not opened as a primary. The office's own site is a navigation hub with little substance behind each heading, so its silence is a hint rather than proof.

    Still needed: A page on veterans.alaska.gov naming the women veterans coordinator and what the post does, or a departmental statement that no such post exists.

  • State or borough funded transport to federal medical care

    medium confidence it exists · To be identified

    No state or borough transport programme surfaced. What exists on the published position is a volunteer van network run by a national charity in partnership with the federal health system and coordinated through hospital service coordinators — federal and charitable, not a state benefit, and therefore outside this corpus. In a state where many communities have no road connection at all, whether any state or borough programme fills the gap is a question worth settling rather than leaving.

    Still needed: A state, borough or regional transit page naming veteran transport to medical care, or a departmental statement that none exists.

Arkansas — 13 on the worklist

A first pass over Arkansas statewide law: the full homestead and personal property exemption under ACA §26-3-306, read from the statute. Geography is complete for all 75 counties; county tax rates and the local layer are not.

  • State income tax treatment of military retirement

    high confidence it exists · To be identified

    How Arkansas taxes military retirement decides real money and is unread here — published only once the statute or revenue department page is read.

    Still needed: The statute or the administering agency page, read directly.

  • SERVICE-CONNECTED disabled veteran plate

    high confidence it exists · ACA Title 27, ch. 24 (§27-24-204 area)

    Narrowed 23 Aug 2026: the 100% NON-service-connected plate is now published as ar-dv-plates from the finance department's own page (free first plate, $4 additional, $4 surviving-spouse reissue). The service-connected plate — reported at a 10% gate after a 2025 expansion from 30% — remains unreadable from every primary: a browser session enumerated the department's ENTIRE Military specialty-plate category (20 plates) and found no service-connected disabled veteran page at all; arkleg.state.ar.us refused the browser outright, and the official code publisher (advance.lexis.com, linked from the department's own header) refused it too. Earlier attempts: .../specialty-plates/disabled-veteran-license-plate and .../specialty-plates/military/ 404 or redirect, ssl-dfa ark.org hosts do not resolve.

    Still needed: ACA Title 27 ch. 24 read directly (arkleg or the official publisher), or a department publication that actually names the service-connected plate, its rating gate and its fees.

  • Veterans preference in public employment

    high confidence it exists · To be identified

    Every mature state in this corpus operates one; the mechanics differ.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Arkansas has 75 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Automatic occupational licensure for service members, veterans and spouses

    high confidence it exists · Ark. Code §17-1-106; Ark. Code §17-7-104 (Act 820 of 2019)

    Two named statutes and a 2019 act govern automatic licensure and continuing-education exemptions here, and board pages name them without stating the fee treatment or the deadline. Tried labor.arkansas.gov board pages (content truncated on every board read), codeofarrules.arkansas.gov (connection refused) and arkleg.state.ar.us (connection refused).

    Still needed: The statute text of §17-1-106 or §17-7-104, or a board page that states the fee and the timeframe, read directly.

  • State emergency or financial assistance fund for veterans

    medium confidence it exists · To be identified

    Search-level material describes a state veterans emergency fund paying one-off grants for medical costs, emergency home repairs and utility shut-offs, decided case by case, with county service officers helping veterans apply. No page on the department's own site and no statute stating those terms was reachable this session, so none of it is published.

    Still needed: The department page or the statute establishing the fund, with its cap, eligibility and application route.

  • Whether the state veterans cemeteries require residency

    medium confidence it exists · Ark. Code §20-81-112

    The cemeteries page read this session carries locations, eligibility classes, the 24-month service rule and the $807 family interment fee, but says nothing about residency either way. The state veterans cemetery system statute would settle it and the legislature's host refuses every tool available.

    Still needed: Ark. Code §20-81-112 read in full, or a departmental statement on residency.

  • State consumer and legal protections beyond the federal civil relief act

    medium confidence it exists · To be identified

    Every route to the primary sources closed this session. The code host and the administrative rules host refuse outright. The attorney general's site returned 403 to automated reading, including its own landlord and tenant rights page, which is where a military termination ground would be described if one existed. The veterans department links out to a university law clinic instead of stating any state protection of its own. Nothing on lease termination on orders, an interest cap, deployed-parent custody or protection of compensation from garnishment could be read from a primary source.

    Still needed: The Arkansas Code landlord-and-tenant and domestic-relations provisions, or the attorney general page, read directly.

  • The funeral honours stipend rate and deadline

    high confidence it exists · ADVA Memorandum of Agreement

    The programme is now published from the department's own page. What that page does not carry is the money: the rate per honours detail, any per-day cap, and any submission deadline all sit in a Memorandum of Agreement the department tells organisations to read before applying, and the agreement is not reproduced or linked as a document on the page. The page also prints an Eligibility heading with nothing under it.

    Still needed: The ADVA Military Funeral Honors Memorandum of Agreement, or a department statement of the rate.

  • Whether any utility or energy programme has a veteran route

    low confidence it exists · To be identified

    The state services portal's military and service member page names emergency management, education, tax forms, federal VA offices and absentee ballots, and nothing on utilities. The veterans department site index carries no energy or utility page. Neither is an exhaustive search of the state's assistance programmes.

    Still needed: A public service commission or human services page naming a veteran route into energy assistance.

  • The sixteen veterans treatment courts — districts, eligibility and what completion earns

    high confidence it exists · Ark. Code tit. 16, ch. 101 (veterans treatment specialty court programs)

    Every primary host refused this session. https://arcourts.gov returned ECONNREFUSED to the fetch tool and was denied navigation in the browser; https://arkleg.state.ar.us was denied navigation, so the chapter text and Act 691 of 2025 could not be read; https://bentoncountyar.gov returned 403 to the fetch tool and a hard Cloudflare block page in the browser. Search-level material says sixteen courts run in this state and that the programmes offer treatment and support in lieu of jail or a criminal record. None of that is published because none of it was read from the judiciary, the code or a county court.

    Still needed: The judiciary specialty court pages or the chapter text, read directly, giving the districts, the eligibility gate and what completion earns.

  • The disabled veteran property tax exemption — the section text itself

    high confidence it exists · Ark. Code §26-3-306

    The published record ar-26-3-306-exemption was re-sourced on 23 August 2026 off a commercial code reproduction and onto two agency publications — the veterans department's Veterans Guide to Property Taxes in Arkansas (2024), which quotes §26-3-306(a)(1)(i), and the assessment coordination division's tax FAQ. Neither states the renewal rule, whether the exemption travels between counties, the acreage the term homestead reaches, or the exact surviving-spouse proviso. Every primary refused this session: https://www.arkleg.state.ar.us/Home/Arkansas-Code and https://www.arkleg.state.ar.us/Acts/FTPDocument?path=%2FACTS%2F2023R%2FPublic%2F&file=395.pdf were denied navigation in the browser and returned ECONNREFUSED on 170.94.58.7 to the fetch tool; https://webftp.blr.arkansas.gov/Home/FTPDocument returned no response to curl; https://advance.lexis.com, the official code publisher linked from the legislature's own site, was denied navigation; https://acd.arkansas.gov and https://www.acd.arkansas.gov do not resolve. A 2025 bill (HB1129) is reported to have amended the definition of homestead to increase the contiguous acreage from assessment years beginning on or after 1 January 2025, and that amendment is unread.

    Still needed: §26-3-306 read in the code or in the enacting act, giving the renewal rule, the homestead acreage after the 2025 amendment, the surviving-spouse proviso in full, and whether eligibility persists across county lines.

  • State or county funded transport to federal medical care

    medium confidence it exists · To be identified

    The department's service index was read this session and names no transport programme. What surfaced instead is a volunteer van network run by a national charity with the federal health system, with vans stationed in a dozen towns and coordinated through hospital service coordinators — federal and charitable rather than a state benefit. Whether any county veteran service office funds mileage or fares of its own was not established.

    Still needed: A department or county veteran service office page naming veteran transport or mileage reimbursement, read directly.

Colorado — 9 on the worklist

A first pass over Colorado statewide law: the constitutional exemption of half the first $200,000, including Amendment G’s extension to individual unemployability. Geography is complete for all 64 counties; county tax rates and the local layer are not.

  • The pension and annuity subtraction that replaces the military one at 55

    high confidence it exists · To be identified

    Established this session: the military retirement subtraction is written for retirees UNDER 55 and is capped at $15,000 through tax year 2028, and at 55 a retiree claims the general pension and annuity subtraction for the same income instead. The revenue department's Retired Servicemembers page states the split but not the dollar limit on the general subtraction, so the amount a retiree at or over 55 can actually take is unknown here. Tried https://tax.colorado.gov/retired-servicemembers and https://tax.colorado.gov/military-servicemembers, both read; the linked guidance publication Income Tax Topics: Military Servicemembers was not opened.

    Still needed: The revenue department guidance publication on military service members, or the codified subtraction provision, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer is now OPEN for this state: the flagship metro transit fare is published. Remaining: every other transit authority, county and municipal programme - the layer is a permanent workstream, not a single record.

    Still needed: The statute or the administering agency page, read directly.

  • Direct emergency financial assistance for an individual veteran

    medium confidence it exists · To be identified

    Established this session: the division's two grant programmes are organisational only — the Veterans Assistance Grant for nonprofits outside 501(c)(19) and (23) and for governmental entities, the Veterans Trust Fund only for nationally recognised veterans service organisations inside those codes. Neither has a veteran-facing application. Whether any direct relief route exists, at state or county level, is unresolved.

    Still needed: A division or county veterans service officer page describing direct assistance to an individual, with its terms.

  • The cemetery at the veterans home in Monte Vista

    medium confidence it exists · To be identified

    Corrected this session. The STATE cemetery is the Veterans Memorial Cemetery of Western Colorado at Grand Junction, run by the Department of Military and Veterans Affairs, and it is now published. A SECOND, separate burial ground exists at the veterans home in Monte Vista: the Restoration of Honor Act page names burial eligibility at the Homelake cemetery as one of the things that status opens, which means it has its own eligibility rule. Whether it is open to veterans generally or only to residents of that living center is unknown. Tried https://cdhs.colorado.gov/homelake (page not found) and searched the human services site, which returns only https://cdhs.colorado.gov/vclc-homelake for the living center itself, with nothing about the cemetery.

    Still needed: A human services or military and veterans affairs page describing the Monte Vista cemetery and its eligibility, read directly.

  • Free DD214 recording, and any veteran fee waiver on vital records

    medium confidence it exists · To be identified

    Two separate questions, neither settled this session. (1) County clerks appear to record a discharge document at no charge and to release certified copies to the veteran and next of kin, but that is a county-by-county practice and no clerk's own page was read this session, so nothing is published. (2) No veteran fee waiver on birth, death, marriage or divorce records was found on any state page. The division's own archives page, read at https://vets.colorado.gov/services/archives-and-records, is about WHERE records are held — the military and veterans affairs archive for Guard separations before 2007, the National Archives otherwise — and says nothing about fees at all.

    Still needed: A county clerk and recorder page stating the recording and copy fee for a discharge document, and the public health department vital records fee schedule, both read directly.

  • State-funded counselling for a veteran who does not live in a living center

    medium confidence it exists · To be identified

    Opened by this session's finding that the state's session reimbursement programme, enacted by HB23-1088, is limited to veterans who live in a veterans community living center and requires federally covered sessions to be exhausted first. That leaves the great majority of veterans in the state outside it. Search-level material names a separate no-cost pilot in one county and a crisis follow-up programme run with the state crisis service; neither was opened, and no administering page for either was read. The provider list the behavioural health administration is required by the act to publish was searched for on its site and not found.

    Still needed: The behavioural health administration page for the participating provider list, and an administering page for any counselling programme open to veterans living at home, read directly.

  • Residential lease termination on military orders

    high confidence it exists · C.R.S. 38-12-1101 et seq.

    The state is understood to carry a lease-termination provision for tenants in military service in title 38 of the revised statutes, but it could not be read. Every colorado.gov host refuses automated fetching, and the legislative content host that serves the statute PDFs returned 403 as well, both at leg.colorado.gov and at the content.leg.colorado.gov address it redirects to. Nothing about the notice period, the penalty cap or whether a spouse is covered is asserted on that basis.

    Still needed: C.R.S. 38-12-1101 to 38-12-1105 read in full, in a browser if the fetch hosts continue to refuse.

  • The veterans court statute text, and the section carrying the sealing factor

    high confidence it exists · C.R.S. 13-5-144; the criminal records sealing statute

    The veterans courts are now published from the judicial branch's own programme pages and from the General Assembly's page for the enacted 2018 act. What was NOT read is statutory text: https://content.leg.colorado.gov returned 403 for the signed act PDF, and no section text for C.R.S. 13-5-144 was reached. The 2018 act's summary says a court weighing a petition to seal must treat successful completion of a veterans programme as a favourable factor, and the section number carrying that duty was not identified.

    Still needed: C.R.S. 13-5-144 in full, and the sealing section that carries the favourable-factor duty, read from the statute rather than from a bill summary.

  • State or county funded transport to federal medical care

    medium confidence it exists · To be identified

    The division's services and benefits index was read in full this session and names no transport programme of any kind. The transit discount already published in this corpus is a metro fare discount, not medical transport. Whether any county veteran service office or rural transit authority funds rides to federal medical facilities was not established.

    Still needed: A county veteran service office page or a rural transit authority page naming veteran medical transport, read directly.

Connecticut — 12 on the worklist

A first pass over Connecticut statewide law: the brand-new PA 24-46 full exemption of the primary residence at 100% permanent and total. Geography is complete for all 8 counties; town tax rates and the local layer are not.

  • Hunting, fishing and state park concessions

    high confidence it exists · To be identified

    Thresholds ranged from any-degree to 100% across researched states; nothing is assumed.

    Still needed: The statute or the administering agency page, read directly.

  • Veterans preference in public employment

    high confidence it exists · To be identified

    Every mature state in this corpus operates one; the mechanics differ.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Connecticut has 8 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Occupational licensing for veterans and military spouses

    high confidence it exists · To be identified

    No licensing page for veterans or military spouses appears on the veterans department site, and the statute host refused every tool this session — cga.ct.gov returned a connection refusal on each attempt. The set-aside statute §4a-60g and the price preference §4a-59 were both reached only through the procurement manual.

    Still needed: The Department of Consumer Protection or eLicense military page, or the statute text, read directly.

  • Sgt. John L. Levitow Healthcare Center admission and cost

    high confidence it exists · To be identified

    The skilled nursing side of the Rocky Hill campus publishes no eligibility, no cost to a resident and no spouse policy — its page directs applicants to an admissions phone line and a downloadable form.

    Still needed: The admission application form or a page stating eligibility and cost, read directly.

  • Soldiers, Sailors and Marines Fund — amount, frequency and duration limits

    high confidence it exists · Conn. Gen. Stat. §§27-138, 27-140

    The fund is published this session with its covered and not-covered lists intact, but it states only that assistance is limited in amount, frequency and duration as specified by the State Fund Commission — and publishes none of those figures. The statute text is also unread: the legislature's host refused every connection attempted (cga.ct.gov returned ECONNREFUSED).

    Still needed: The State Fund Commission limits, and §§27-138 and 27-140 read in full.

  • What a spouse or minor child interment costs at the state cemeteries

    medium confidence it exists · To be identified

    The department publishes the veteran's cost as nothing and the marker as free, and is silent on family interments. It also states the discharge floor two different ways on two of its own pages — other than dishonorable in the eligibility article, no bad conduct or other than honorable on the cemetery pages.

    Still needed: A departmental fee schedule, and a single authoritative statement of the discharge floor.

  • Whether a town or the state pays a burial allowance for a veteran

    medium confidence it exists · Conn. Gen. Stat. ch. 506

    Two burial payments were established this session and neither is a veteran burial allowance: the state reimburses part of the cost of setting a federal marker in a private cemetery, and social services pays a general-population funeral and burial allowance of $1,800 with no veteran route in it. Whether chapter 506 of the General Statutes separately obliges a town to bury an indigent veteran, or sets an allowance, could not be established — cga.ct.gov refused every connection this session, at www.cga.ct.gov and at cga.ct.gov alike.

    Still needed: Chapter 506 of the General Statutes read in full from a host that will serve it.

  • State consumer and legal protections beyond the federal civil relief act

    medium confidence it exists · To be identified

    The veterans department site was read across its service index this session and carries nothing on lease termination on orders, contract cancellation, an interest cap or deployed-parent custody; it links to an outside legal aid organisation instead. The General Statutes host refused every connection, so the code itself could not be searched and no absence can be inferred.

    Still needed: The General Statutes landlord-and-tenant and family provisions, read directly.

  • The diversionary programme statute and the veteran definition it turns on

    high confidence it exists · Conn. Gen. Stat. § 54-56l; § 27-103a

    The programme is now published from the judicial branch's own brochure, decrypted from the PDF this session. The statute hosts refused entirely: https://www.cga.ct.gov returned ECONNREFUSED to the fetch tool at both /current/pub/chap_960.htm and /2015/BA/, and the browser was denied navigation to cga.ct.gov altogether. Two different veteran definitions are in play — the brochure's 'not dishonorable' test and the § 27-103a definition the veterans department certifies against — and which governs which court programme is unresolved.

    Still needed: § 54-56l and § 27-103a read in full, in a browser or a mirror that is not the refusing host.

  • The municipal veterans representative in every town

    high confidence it exists · Conn. Gen. Stat. § 27-135

    The veterans department's advocacy index links a municipal veterans representative programme, but only as an interactive map application with no readable text page behind it. Search-level material says the programme dates from 2013, requires the chief executive of each municipality to appoint a representative, and has since added annual training and reporting requirements. None of that was read from the department or the statute, so nothing is published.

    Still needed: A department page describing the programme, or § 27-135 read in full, giving the appointment duty, the training requirement and what a representative can actually do.

  • A state women veterans coordinator or programme

    medium confidence it exists · To be identified

    Read this session: the veterans department's homepage and its advocacy and assistance index. The only women veterans item on either is an outbound link to the federal centre for women veterans, and the department describes 'frontline support of and assistance with women Veterans issues' as a function of its advocacy office rather than as a named post or programme. That is a hint of absence, not proof, because the knowledge base is large and was not read exhaustively.

    Still needed: A department page naming a women veterans coordinator or programme, or a departmental statement that the function sits inside general advocacy.

Delaware — 11 on the worklist

A first pass over Delaware statewide law: the Disabled Veterans School Tax Credit, read from the Department of Finance. Geography is complete for all 3 counties; county tax rates and the local layer are not.

  • Hunting, fishing and state park concessions

    high confidence it exists · To be identified

    Thresholds ranged from any-degree to 100% across researched states; nothing is assumed.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Delaware has 3 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Professional licensing for veterans and military spouses

    medium confidence it exists · To be identified

    The Division of Professional Regulation was not reached this session. Whether a temporary or expedited licence exists for a military spouse here, and whether any fee is waived, is unread.

    Still needed: The Division of Professional Regulation military page or the Title 24 provision, read directly.

  • What a Veterans Home resident actually pays

    high confidence it exists · To be identified

    Both agency pages say cost varies with the payer source and name no rate, no income formula and no federal per diem offset. That is the single question every family asks first.

    Still needed: A published rate schedule or the admissions office terms, read directly.

  • Veterans Trust Fund — maximum award and frequency limits

    high confidence it exists · Del. C. tit. 29, §8804(a)(4)

    The fund is published this session from the statute, the agency page and the application form. None of the three states a maximum award, a per-year limit or a lifetime limit, and the form simply asks the applicant to name an amount — which suggests the Executive Committee sets it case by case, but nothing read says so.

    Still needed: A committee policy or fee schedule stating the award limits.

  • Interment fee for a spouse or dependent at the state cemeteries

    medium confidence it exists · To be identified

    The eligibility material read this session says no fee is charged for the plot or interment of an eligible veteran, and that the Commission may establish reasonable fees for the immediate family. The fee schedule itself was not found on the office's pages.

    Still needed: The Commission fee schedule for family interments.

  • Whether custody law protects a deployed parent

    medium confidence it exists · Del. C. title 13

    Title 13, Domestic Relations, was read at chapter level this session. Its chapters run from marriage through parentage, adoption, divorce, the child-custody jurisdiction act, third-party visitation and departmental custody, and none of them is a deployed-parents custody and visitation chapter. A protection could still sit inside chapter 7 or chapter 19 as a section rather than a chapter, which a chapter list would not show.

    Still needed: Title 13 chapters 7 and 19 read at section level, or a Family Court statement.

  • Whether any utility or energy programme has a veteran route

    low confidence it exists · To be identified

    The veterans office site index and its benefits page were both read this session and neither names a utility discount, a lifeline supplement or an energy assistance route for veterans. The natural resources department's energy programme pages were not reached, so this is silence rather than an established absence.

    Still needed: The state energy assistance programme pages, read directly.

  • What completing the veterans treatment court earns, and its statutory authority

    high confidence it exists · To be identified

    The court is now published from the veterans office page, which carries eligibility, the discharge gate and the mentor structure. What that page does not state is the charge types accepted, the length of the programme, the number of phases, or what successful completion earns — dismissal, expungement, a reduced sentence or nothing at all. It names no code section either. The court system's own pages were not reached this session.

    Still needed: A court page or participant handbook giving the accepted charges, the programme length and the disposition on successful completion.

  • The enrolled text of the act creating the veterans affairs department

    high confidence it exists · House Bill 1 (2025)

    The creation of a cabinet-level department is published this session from the state news service announcement, which gives the signing date, the 2030 independence deadline, the veteran requirement for the secretary and the continuing role of the commission. The enrolled act was not read, so which statutory functions transfer, when each transfers, and what happens to the existing office's duties are all unestablished.

    Still needed: The enrolled act text from the General Assembly, giving the transferred functions and the transition dates.

  • A state women veterans coordinator or programme

    medium confidence it exists · To be identified

    Read this session: the veterans office homepage, which lists eleven programme pages, and its health resources page. Neither names a women veterans coordinator, a women veterans programme or any women-specific health provision. With a new department standing up, the absence may be a transition artefact rather than a settled position.

    Still needed: A veterans office or successor department page naming a women veterans post or programme, or a statement that none exists.

District of Columbia — 13 on the worklist

A first pass over District law: the $445,000 Disabled Veterans Homestead Deduction, read from the Office of Tax and Revenue. The District has no counties; ward-level programmes are unresearched.

  • Hunting, fishing and state park concessions

    high confidence it exists · To be identified

    Thresholds ranged from any-degree to 100% across researched states; nothing is assumed.

    Still needed: The statute or the administering agency page, read directly.

  • Disabled veteran plates and registration

    high confidence it exists · To be identified

    Plate fee treatment differs plate-by-plate within a single state.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. District of Columbia has 1 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Whether the District operates a veterans home of its own

    high confidence it exists · D.C. Code §§49-1001 to 49-1006

    The veterans office lists its services and none is a long-term care facility, and the chapter establishing the office lists six sections with no home among the headings. That is suggestive but not a statement of absence, and an absence record needs the agency to say so. The federal Armed Forces Retirement Home in the District is a federal facility, not a District one, and must not be published as a District benefit.

    Still needed: A District page or statute section that states the position directly, read in full.

  • Occupational licensing for veterans and military spouses

    medium confidence it exists · To be identified

    The licensing department’s own occupational licensing FAQ carries nothing on military members, veterans or spouses — no expedited route, no temporary licence, no fee waiver. Absence of mention is not absence of law, and the D.C. Code was not searched exhaustively.

    Still needed: A licensing department military page, or the D.C. Code provision, read directly.

  • Whether the statutory veteran transportation programme is running

    high confidence it exists · D.C. Code §49-1003

    The statute is published this session with its numbers intact — 80% of area median income, at least 15 one-way trips a month, six days a week, trips beginning and ending in the District — but the duty is expressly subject to the availability of funding and the office's own pages describe no such programme. Nothing read this session says whether it operates, under what name, or how a veteran enrols.

    Still needed: An office page or budget document naming the operating programme and its intake.

  • District emergency financial assistance for veterans

    medium confidence it exists · To be identified

    Read this session: the veterans office publishes claims assistance, the homestead deduction and outreach, and §49-1003 creates no relief fund. Search-level material describes homelessness-prevention money reaching veterans through a housing agency and outside emergency assistance programmes rather than through a veterans fund.

    Still needed: A District agency page describing veteran-specific emergency financial assistance and its terms.

  • A veteran track on the real property tax deferral

    medium confidence it exists · D.C. Code §47-845.02

    Read this session at https://code.dccouncil.gov/us/dc/council/code/sections/47-845.02: the deferral is real — tax above the prior year's amount may be deferred at 1/2% simple interest a month, capped so the deferred total cannot reach 25% of assessed value — but it turns entirely on household adjusted gross income below $50,000 and contains no veteran provision at all. A separate section covers low-income seniors. Neither was published as a veteran benefit because neither is one.

    Still needed: Either a veteran-specific deferral provision elsewhere in Title 47, or an Office of Tax and Revenue statement that the income-tested deferral is the only one available.

  • The terms of the Guard tuition assistance programme

    high confidence it exists · D.C. Code §49-807

    The statute is published this session and is a bare spending permission: District funds may be used, at the Guard's discretion, for tuition assistance for all members or for new recruits who are District residents. It names no amount, no institution, no service obligation and no deadline. Everything operational sits outside the code and no Guard programme page was reachable this session.

    Still needed: The Guard education office's own published programme terms — the award amount, eligible institutions, service obligation and application window.

  • Whether the District has a lease-termination right for servicemembers

    medium confidence it exists · D.C. Code title 42

    Title 49, the Military title, was read at chapter level this session: its eleven chapters cover organisation, courts-martial, pay and the education compact, and none is a civil relief chapter. The landlord and tenant chapter at title 42 chapter 32 was also read at section-heading level and carries no military provision. That is suggestive of absence but not proof, because neither reading was section-by-section across the whole title, and an absence record needs better than a table of contents.

    Still needed: A section-level search of D.C. Code title 42, or a housing agency statement, read directly.

  • Whether any utility discount programme has a veteran route

    low confidence it exists · To be identified

    No veteran route into a utility discount, a lifeline supplement or energy assistance was established this session. The code search performed reached debt collection and garnishment rather than the public utilities title, and the energy and environment department's programme pages were not read.

    Still needed: The utility discount programme pages, or the public utilities title, read directly.

  • A District women veterans programme

    medium confidence it exists · To be identified

    Read this session: the veterans office landing page, which lists every programme and service it links — a homestead deduction application, claims assistance, resident resources, a crisis line, boards and commissions, a community grant programme, events and an intake form. None is a women veterans programme. The community grant programme page was read too and carries three funding priorities, none of them veteran-specific and none women-veteran-specific. Search-level material says the office advocates for women veterans through partnerships and policy work, which is not a programme and was not read from the office.

    Still needed: A veterans office page naming a women veterans programme or coordinator, or a statement that the function sits inside general advocacy.

  • Whether the veterans navigator office still exists

    high confidence it exists · To be identified

    A court system page describing a veterans navigator office — room 120B of the main courthouse, linking court-involved veterans to legal, housing, mental health, treatment, employment, discharge-upgrade and claims help — is still indexed by search engines and returns 404 from the court system's own host. The complete published sitemap of 1,454 URLs contains no veteran page at all. That is published as an absence, but a removed page is a different fact from a never-existing one and the difference matters to a veteran with a case.

    Still needed: A court system statement on whether the navigator office operates, or a current page for it under a new address.

Hawaii — 13 on the worklist

A first pass over Hawaii law: the totally disabled veteran home exemption — which is COUNTY law here, and differs across all four counties. Geography is complete for all 5 counties; county rates and the rest of the local layer are not.

  • Freshwater game fishing licence fee, and state park entry

    medium confidence it exists · HRS §187A-5 rules; HRS chapter 184

    The hunting licence and the nonresident marine fishing licence were read this session and are now published: both carry a serving-member rate and neither carries a disabled-veteran concession. Two gaps remain. The freshwater game fishing licence fee is not in statute at all — chapter 187A leaves fees to departmental rule under §187A-5, and that rule was not read. State park entry under chapter 184 was not opened.

    Still needed: The departmental fee rule for freshwater game fishing, and the park entry fee schedule, read directly.

  • Disabled veteran plates and registration

    high confidence it exists · To be identified

    Plate fee treatment differs plate-by-plate within a single state.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Hawaii has 5 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • County purchasing — any veteran term the state code does not carry

    low confidence it exists · County purchasing rules under HRS chapter 103D

    The state question is settled and published as an absence: Part X of the procurement code enumerates every preference it creates and none is a veteran, and the State Procurement Office's own Preferences page lists the same set. What was NOT read is the county layer. Each county buys under the same chapter through its own purchasing division with its own vendor pages, and none was opened this session.

    Still needed: The four county purchasing pages or their vendor guides, read directly.

  • Tuition assistance rules — award ceilings, fields of study, reenlistment obligation

    high confidence it exists · Rules adopted under HRS §121-45(b)

    The statute and the programme's own application page were both read this session and the record is published from them. The statute requires rules covering minimum qualifications, acceptable fields of study, periods of eligibility and 'any reenlistment obligations', and the programme pays 50% toward a first master's degree even though §121-45(a) reaches undergraduates. That extension, and any service obligation attached to an award, live in rules that were not located. Searching the administrative rules index was not attempted; the programme page cites no rule number.

    Still needed: The adjutant general’s administrative rules under §121-45(b), read directly.

  • Vital records fee waiver — departmental practice on copies, family and proof

    medium confidence it exists · HRS §338-14(a) as administered

    HRS §338-14 was read this session and the free-copy duty is published from it. The statute caps nothing: no limit on the number of free copies, no definition of 'immediate family', and no stated evidence standard for the service claim the copy supports. The health department's own vital records pages would carry that practice. health.hawaii.gov refuses automated fetching like every hawaii.gov host, and it was not opened in the browser this session.

    Still needed: The health department vital records fee and application pages, opened in a browser.

  • State emergency or financial assistance for veterans

    medium confidence it exists · To be identified

    The office's Benefits and Services page, opened in a browser this session, lists advocacy, claims help, burials of indigent veterans, employment, grant-in-aid support for veteran organisations and the tax exemptions — and no emergency relief fund for an individual veteran. Assistance with burials of indigent veterans is the closest thing on the list and has no page of its own.

    Still needed: The indigent burial assistance terms, or a departmental statement that no emergency fund exists.

  • State cemetery residency requirement and family interment fees

    medium confidence it exists · To be identified

    The Kāneʻohe burial sheet read this session covers eligibility classes, what the cemetery provides and the marker standards, but states no residency requirement and no fee schedule for a spouse or dependent interment. The county-run cemeteries on the other islands publish nothing of their own.

    Still needed: A cemetery rules document or county page stating residency and family fees.

  • The rest of the civil relief chapter — default judgments, mortgages, taxes

    high confidence it exists · HRS ch. 657D

    Four sections of chapter 657D were read in full this session and three are published: lease termination, the interest cap and eviction protection. The chapter has roughly forty more, including default judgments and appointed counsel at §657D-11, stays of proceedings at §657D-12, installment contracts at §657D-22, mortgages and trust deeds at §657D-23, the tax-sale protections in part V and the health insurance reinstatement right at §657D-63. Each is a distinct protection and none has been read.

    Still needed: The remaining sections of HRS chapter 657D read in a browser at capitol.hawaii.gov.

  • Whether any utility programme has a veteran route

    low confidence it exists · To be identified

    No veteran discount, lifeline supplement or veteran preference inside an energy assistance programme was found on any state host read this session. Every hawaii.gov host refuses automated fetching, so this class was only reachable in a browser and the browser time this round went to the statutes.

    Still needed: The public utilities commission and human services programme pages, read in a browser.

  • What completing the veterans treatment court earns, and its statutory authority

    high confidence it exists · To be identified

    The court is now published from the judiciary's own page, which gives the two circuits, the start years, the weekly docket, the testing regime and the mentor pairing. It does not state the discharge requirement, the accepted charge types, the programme length or what successful completion earns, and it cites no statute. A referral process document is published by the judiciary and was not opened.

    Still needed: The judiciary referral process document, or a participant handbook, giving the eligibility gate and the disposition on completion.

  • Whether the women veterans counsellor post is filled today

    high confidence it exists · Act 209

    The office's own page states that an Act appropriated funds for a veterans services counsellor IV position with a primary focus on female veterans. It gives no year for the Act, no post-holder and no current status. A vacant post published as if staffed was found in another state this same round, which is reason enough to check rather than assume.

    Still needed: The Act text with its year, and a current staff listing or statement showing whether the post is filled.

  • Reduced transit fares for veterans on the other islands

    medium confidence it exists · County ordinance or transit policy

    The Oahu disability reduced fare route is now published from the city transport department's application instruction sheet, including the VA-letter shortcut. The transit operator's own fare pages refused every request (https://www.thebus.org returned ECONNREFUSED and was denied navigation in the browser), so the fare prices themselves were not read, and nothing at all was established for the other counties, which run their own systems and fare structures.

    Still needed: The Oahu fare price table, and the reduced fare pages for the other counties, read directly.

Idaho — 15 on the worklist

A first pass over Idaho statewide law: the $1,500 veteran property tax benefit, read from the State Tax Commission. Geography is complete for all 44 counties; county tax rates and the local layer are not.

  • Hunting, fishing and state park concessions

    high confidence it exists · To be identified

    Idaho's DAV programme is well-shaped at the search level: a $5 resident licence at a 40%+ service-connected rating, with reduced DAV big-game tags (deer $10.75, elk $16.50, bear $6.75, turkey $10.75) — one of very few states discounting ELK. idfg.idaho.gov refused the connection, so the shape rests on secondary summaries and stays here.

    Still needed: The statute or the administering agency page, read directly.

  • Disabled veteran plates and registration

    high confidence it exists · To be identified

    Plate fee treatment differs plate-by-plate within a single state.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Idaho has 44 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Veteran-owned business preference in state procurement

    medium confidence it exists · Idaho Code §67-2349; Idaho Code title 67 ch. 92

    The purchasing division’s laws and policies page names only the reciprocal preference for out-of-state vendors and no veteran preference or set-aside. That is a strong hint of absence, but the page is about exemptions from competitive solicitation rather than a complete list of preferences, so it does not carry an absence record on its own.

    Still needed: The State Procurement Act preference sections, or a purchasing division statement, read in full.

  • Joining Forces Idaho grant — cap and eligibility floor

    high confidence it exists · To be identified

    The programme itself is now published, from the 2026 application form read this session. What the form does NOT contain is any award cap, service-length floor or income threshold — it says only that the funders make the final decision on whether to support and how much. So the amount a veteran can actually expect remains unknown, and that is the open question.

    Still needed: A Joining Forces policy document or division policy statement setting the award cap and the eligibility floor.

  • Whether a county or state burial allowance exists for a veteran

    medium confidence it exists · Idaho Code Title 65

    The state cemetery fees are published here already, but a burial ALLOWANCE — a county duty to bury an indigent veteran, a headstone-setting reimbursement, a funeral honours stipend — is a different thing and none appears on the veterans division's benefits pages read this session. The code chapter that would carry it could not be opened: legislature.idaho.gov returned ECONNREFUSED on every attempt, at the chapter index and at the section level.

    Still needed: Idaho Code Title 65 chapter 1 read directly, or a division statement that no burial allowance exists.

  • State consumer and legal protections beyond the federal civil relief act

    medium confidence it exists · To be identified

    Nothing on residential lease termination for deployment or a change of station, contract cancellation, an interest cap below the federal six per cent, foreclosure or default-judgment protection, or deployed-parent custody was found on any readable state host this session. The veterans division links out to a university legal clinic rather than stating any state protection of its own. The statute host refused every connection, so absence cannot be inferred from silence.

    Still needed: The Idaho Code provisions on landlord and tenant, and on domestic relations, read directly.

  • Current state cemetery interment fee

    medium confidence it exists · IDAPA 21.01.04

    The fee published this session is $978 for fiscal year 2025, taken from the division's own Boise information sheet. It tracks the VA burial plot allowance and resets each 1 October, so the figure carried here is behind. The cemetery rules at IDAPA 21.01.04 were identified but not read.

    Still needed: The current fiscal year information sheet, or IDAPA 21.01.04 read in full.

  • State Education Assistance Program — National Guard tuition

    high confidence it exists · Idaho Code §46-314

    The military division's education services page was read this session (https://www.imd.idaho.gov/education-services/) and describes the programme in one sentence — reimbursement for qualifying higher and vocational education — with no dollar cap, no eligibility criteria and no deadline, routing every question to a phone number and an email address. The statute could not be read: https://legislature.idaho.gov/statutesrules/idstat/Title46/T46CH3/SECT46-314/ returned ECONNREFUSED. Search-level material describes a per-fiscal-year ceiling and a 2027 funding cut; none of that was read from a primary source and none is published.

    Still needed: Idaho Code §46-314 read in full, or a military division page stating the SEAP ceiling, eligibility and application window.

  • The fish and game price table behind the disabled veteran licence

    high confidence it exists · Idaho Code Title 36

    The disabled veteran licence and its tag prices are published this session from the veterans division's own state benefits page. The fish and game department's own price table was not read — idfg.idaho.gov returned ECONNREFUSED on every attempt, as did the legislature host. Whether the concession extends to controlled hunt applications, stamps and permits is unanswered.

    Still needed: The fish and game department's licence and tag price table, and the Title 36 fee section, read directly.

  • Plate fees and the disability veteran plate threshold

    high confidence it exists · Idaho Code Title 49

    The veterans division publishes the military plate application forms and the Gold Star fee waiver, but no plate fee schedule and no disability threshold for the disability veteran plate. The transportation department's own fee table was not reached this session and the legislature host refused every connection.

    Still needed: The transportation department's plate fee schedule, and the Title 49 section setting the disability veteran plate threshold.

  • The veterans treatment courts — districts, eligibility and what completion earns

    high confidence it exists · Idaho Code § 19-5601 et seq.; Idaho Rules for Treatment Courts

    Every primary host refused this session. https://isc.idaho.gov served a hard Cloudflare block page in the browser (not a challenge — a block) and 403 to the fetch tool, taking the treatment courts pages, the veterans treatment court factsheet and the standards document with it; https://adacounty.id.gov returned 403 to the fetch tool and the same hard block in the browser; https://legislature.idaho.gov was denied navigation altogether, so § 19-5601 and § 19-5604 were not read. Search-level material says the treatment court rules are made pursuant to the drug court and mental health court act and that veterans treatment courts sit inside that framework, with disqualifying factors for violent felonies, firearms offences, trafficking and sex offences. None of it is published because none of it was read.

    Still needed: The treatment courts pages or the veterans treatment court factsheet, and § 19-5604, read directly — the Cloudflare block may need a different route entirely.

  • State or county funded transport to federal medical care

    medium confidence it exists · To be identified

    The division's own programme index was read in full this session and names no transport programme. What surfaced is a volunteer van network run by a national charity with the federal health system, coordinated through hospital service coordinators at the federal medical centre — federal and charitable, not a state benefit. Whether any county funds mileage or fares was not established.

    Still needed: A division or county page naming veteran transport or mileage reimbursement to medical care, read directly.

  • A veteran route into state caregiver support, respite or adult day services

    low confidence it exists · Idaho Commission on Aging programmes; Idaho Code title 67, chapter 50

    The Commission on Aging's site navigation was read on 23 August 2026 and names an Idaho Family Caregiver Support Program, a Lifespan Respite Project, chore and homemaker services and case management. The programme pages themselves could not be read: https://aging.idaho.gov/programs/caregiver-support/ returned a navigation shell with no programme content, and three further paths — /idaho-family-caregiver-support-program/, /stay-at-home/idaho-family-caregiver-support-program/ and /how-can-we-help/idaho-family-caregiver-support-program/ — each returned HTTP 404 while rendering the same menu. So the programmes exist by name and nothing about eligibility, cost or a veteran route was established. The legislature's host, which would carry the authorising chapter, remains unreachable.

    Still needed: A working Commission on Aging programme page for the family caregiver support programme and the lifespan respite project, giving eligibility, any cost share, and whether a veteran or a veteran’s caregiver has any route or priority.

  • Whether utility disconnection rules protect a deployed servicemember’s household

    low confidence it exists · IDAPA 31.21.01, Utility Customer Relations Rules; Public Utilities Commission orders

    Two neighbouring jurisdictions in this research round turned out to have express deployment-based disconnection shields written into their utility rules, which makes this worth asking here rather than assuming. Nothing was read either way on 23 August 2026: https://puc.idaho.gov/Home/Consumer returned HTTP 404 and no other path on that host was tried. The published record 'id-joining-forces-idaho-grant' remains the only utilities entry for this state, and it is assistance that pays the provider, not a protection against shutoff.

    Still needed: The Public Utilities Commission’s customer relations rules or its consumer pages, read directly, for any military or deployment provision in the disconnection rules.

Iowa — 8 on the worklist

A first pass over Iowa statewide law: the disabled veteran homestead credit — the whole levy — read from the Department of Revenue, including the acreage rules changing July 2026. Geography is complete for all 99 counties; county tax rates and the local layer are not.

  • Disabled veteran plate routes beyond the federal automobile grant

    medium confidence it exists · Iowa Code §321.34; §321.166

    One route is now published: Iowa Code §321.105(5) was read on 23 August 2026 and exempts a seriously disabled veteran PROVIDED A VEHICLE by the United States government under 38 U.S.C. §§3901–3904 from the annual registration fee, with one free set of regular or military plates, and §35A.11 was read alongside it for where the validation fees on military plates go. That route follows the federal automobile grant, not a disability percentage, so a 100% rated veteran who bought their own car sits outside it. The many military special plates themselves live in §321.34 subsections 16 to 27, and §321.166 governs plate issuance; neither was read this session.

    Still needed: Iowa Code §321.34 and §321.166 as per-section PDFs, and the Department of Transportation’s own disabled veteran plate application.

  • A veteran route inside the state energy assistance programme

    low confidence it exists · Iowa Code chapter 476; Iowa HHS low-income home energy assistance plan

    Searched for a veteran-specific discount, lifeline supplement or priority inside the state's energy assistance route on 23 August 2026 and found none to read. The state programme's own published material describes an income gate of 200% of the federal poverty guidelines and an early-application window from 1 October for households with a member aged sixty or over or with a disability — age and disability, not service. The only veteran-gated utility help actually located in Iowa law is the COUNTY relief already published as 'ia-county-veteran-relief' under Iowa Code §35B.14, which names utilities among the things a county commission may meet for a veteran without means. Nothing statewide was read this session, so nothing is published — and this is recorded as a silence, not as an established absence.

    Still needed: The state energy assistance plan or the utilities regulator’s own rules, read directly, either establishing a veteran route or positively establishing that none exists.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy; Iowa Code §35B.14

    The local layer is now PARTLY open: Iowa Code §35B.14 is published, so the statutory frame for county relief — food, clothing, shelter, utilities, medical benefits and a funeral for indigent veterans — is known. What is not known is any county's actual appropriation, its indigency test, or the funeral cap its board of supervisors sets, and there are 99 of them, each with its own number and none of them in the Code.

    Still needed: A county commission of veteran affairs' own published relief policy or funeral cap, read directly.

  • The income limit on the veterans trust fund

    high confidence it exists · Iowa Administrative Code, agency 801

    Iowa Code §35A.13(8) was read in full and its fifteen spending purposes are published. The statute proves an income limit EXISTS without stating it: paragraph (l) exempts traumatic brain injury screening from the income limit, which only makes sense if one applies to the rest. The number lives in department rules under agency 801 of the administrative code, which were not read this session, so no applicant can work out in advance whether they are inside it.

    Still needed: The administrative code chapter governing the veterans trust fund, read directly.

  • A women veterans programme or coordinator

    low confidence it exists · Iowa Code chapter 35A

    Searched for a statutory women veterans programme on 23 August 2026 and found none. Iowa Code §35A.5 was read in full — seventeen duties of the department — and none of them is a women veterans programme, a coordinator post or a gender-specific service. The chapter 35A section index was read alongside it and carries no such section. The department's own benefits page names no women veterans programme either, and dva.iowa.gov/women-veterans returns 404. This is recorded as a silence rather than an established absence: a coordinator post can exist as an organisational chart entry without appearing in statute.

    Still needed: The department's own staff directory or programme page naming a women veterans coordinator, or a rule under agency 801 establishing one.

  • What the county veteran vans actually run, county by county

    high confidence it exists · Local county commission policy

    The statutory side is now settled and published as 'ia-county-relief-excludes-transport': chapter 35B was read end to end on 23 August 2026 and contains no transportation provision, and §35B.14's list stops at food, clothing, shelter, utilities, medical benefits and a funeral. What is unread is the operational layer, which is where the rides actually are. Several county veteran affairs offices publish their own medical van pages — Des Moines, Crawford, Clinton, Shelby and Floyd counties among them — giving destinations, days of operation and whether the passenger must be ambulatory. Des Moines County's page refused the connection on 23 August 2026 and the others were not read this session. There are 99 counties.

    Still needed: Two or three county veteran affairs offices' own transport pages, read directly, to establish the shape of the typical programme — destination VA facility, cost, booking route, and the ambulatory requirement.

  • Veteran-Directed Care as it is actually delivered through the aging network here

    medium confidence it exists · Federal VA / Administration for Community Living programme, delivered by state aging network agencies

    Caregiver support is the thinnest topic in this corpus and the one route that reaches veterans in this state appears to be Veteran-Directed Care: a federal VA budget the veteran controls, delivered on the ground by aging and disability network agencies rather than by the federal medical centre. The state unit on aging publishes a page for it and two named disability organisations are described as delivering it for the central federal health care system here. None of that was read from a state page this session, and the question that decides whether it belongs in a STATE benefit finder — whether the state contributes anything beyond acting as the delivery agent — is unanswered.

    Still needed: The state unit on aging’s own Veteran-Directed Care page and the area agency intake route, read directly, plus whether any state money sits in it.

  • The transportation department’s own plate, placard and licence pages

    high confidence it exists · iowadot.gov

    Three vehicle records were published on 23 August 2026 using the department’s ADOPTED RULES as the operating source, because the department’s own website could not be reached. iowadot.gov returned HTTP 403 behind Cloudflare to a direct fetch on three separate paths (the license plates page, the veterans designation page and the persons with disabilities parking permit page), and a browser session on the same host stayed on the Cloudflare interstitial through an eight-second wait and a forced reload. The rules turned out to be the better source, but the fee tables and the current form numbers live on the site and are still unread.

    Still needed: Any iowadot.gov page reached from a network the host will answer — specifically the special plate fee table and the current persons-with-disabilities parking permit application.

Kansas — 10 on the worklist

A first pass over Kansas statewide law: the K-40SVR base-year refund for disabled veterans, read from county guidance after the Department of Revenue’s site refused connections. Geography is complete for all 105 counties; county tax rates and the local layer are not.

  • What the free permanent disabled veteran licence actually covers

    high confidence it exists · K.S.A. 32-934; Department of Wildlife and Parks fee schedule

    K.S.A. 32-934 is published from the revisor's own server: a free PERMANENT hunting and fishing licence at a 30% service-connected evaluation. What it does NOT settle is whether stamps, big game tags, park entry and furharvesting sit inside it, or how long processing takes. The department's page was tried at https://ksoutdoors.gov/licenses-permits-fees/special-licenses-permits and returned HTTP 403 to every attempt this session.

    Still needed: The wildlife and parks special licences page or its fee schedule, read directly.

  • State veterans cemeteries — interment eligibility and family charges

    high confidence it exists · K.S.A. 73-1232

    The authorising statute is now published: K.S.A. 73-1232 was read on 23 August 2026 and lets the director of the Kansas Office of Veterans Services establish and maintain a state system of veterans cemeteries, bars a construction contract unless the federal government provides 100% of construction cost, and caps grant applications at three. It contains no eligibility test, no fee and no locations. Those live on kovs.ks.gov, which returned HTTP 403 on the cemeteries path on 23 August 2026 — the same wall recorded against that host in earlier rounds, still unmoved.

    Still needed: A readable kovs.ks.gov veteran-cemeteries page giving locations, eligibility for spouses and dependent children, and any interment charge.

  • The rules the Kansas Office of Veterans Services makes for the benefits it administers

    high confidence it exists · K.S.A. 73-1217; K.S.A. 73-1218; K.S.A. 73-1234; Kansas Administrative Regulations

    Three statutes read on 23 August 2026 hand the operative test to the director of the office rather than fixing it in the Code. K.S.A. 73-1217 makes the director the administrator of the prisoner-of-war and missing-in-action tuition waiver and provides that the qualification of persons as dependents shall be determined by that director, who may adopt rules making the definitions more specific; K.S.A. 73-1218 does the same for the Vietnam-conflict companion waiver; K.S.A. 73-1234 establishes the veterans claims assistance programme with guidelines the office sets. The statutory duties are now published on two of those. The RULES are not: kovs.ks.gov returned HTTP 403 on 23 August 2026 to both the cemeteries path and https://www.kovs.ks.gov/veteran-cemeteries/program-information, the third distinct path refused on that host across three research rounds.

    Still needed: The office’s own rules or application forms for the tuition waivers and the claims assistance programme, read directly — or the relevant Kansas Administrative Regulations article, which was not tried this session.

  • A veteran route inside the state energy assistance programme or a commission-approved discount

    low confidence it exists · Kansas Corporation Commission orders; the state low income energy assistance programme

    Looked for a veteran-gated utility discount, lifeline supplement or heating-assistance priority and read nothing that establishes one. The utilities category is the thinnest in this corpus statewide, and Kansas contributes nothing to it yet. The Corporation Commission's own cold weather rule page WAS tried on 23 August 2026 at https://www.kcc.ks.gov/consumer-information/cold-weather-rule and the host refused the connection outright — ECONNREFUSED on 165.201.7.254:443 to a direct fetch, and HTTP 000 to curl, from two different clients. Not a Cloudflare challenge that clears; an unanswered port. Still not tried: the state energy assistance programme's published eligibility sheet, and the commission's docketed cold weather rule order itself.

    Still needed: The Corporation Commission’s own consumer or cold-weather-rule page from a network it will answer, and the state energy assistance eligibility sheet, read directly.

  • Whether the turnpike gives free or reduced passage to any veteran plate

    low confidence it exists · K.S.A. chapter 68, article 20; Kansas Turnpike Authority tolling schedule

    This state has a real tolled road, so the question is a live one rather than academic. The statutory article was read in full as a section index on 23 August 2026 — turnpike projects, the authority, the general grant of powers, revenue bonds, use and disposition of tolls, tax exemption for bonds, refunding, transfer to the highway system, the two failure-to-pay sections, policing, and new project feasibility — and no section creates a class of exempt users. That is suggestive but not conclusive, because the toll schedule is set by the authority rather than by statute. The authority's own tolling page at https://ksturnpike.com/tolling is behind a hard Cloudflare block: HTTP 403 to a direct fetch and HTTP 403 to curl with a full browser user agent. K.S.A. 68-2006 was read and is the eminent domain section, not the toll-fixing one.

    Still needed: The turnpike authority’s own published toll schedule or exemption policy, read directly — or the toll-fixing section of article 20 read in operative text rather than by heading.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer is now OPEN for this state: the flagship metro transit fare is published. Remaining: every other transit authority, county and municipal programme - the layer is a permanent workstream, not a single record.

    Still needed: The statute or the administering agency page, read directly.

  • Guard educational assistance — the percentage actually paid

    high confidence it exists · K.S.A. 74-32,147 et seq.

    K.S.A. 74-32,145 and 74-32,146 were read on 23 August 2026 and the Board of Regents programme sheet supplied the operating rules, so the programme is published. What is not published is the number that matters: the Regents say the award is 'a percentage of tuition and fees' set by available appropriations and the number of eligible applicants, and print no figure. The award, service-obligation and repayment sections at K.S.A. 74-32,147 onwards were not read, and the chapter index at ksrevisor.gov/statutes/chapters/ch48/ returned 403 while individual section pages served fine.

    Still needed: K.S.A. 74-32,147 to 74-32,149 read section by section, and the Board of Regents’ published award percentage for the current year.

  • Which judicial districts actually run a veterans treatment court

    high confidence it exists · Kansas Supreme Court Rule 191

    The statutory frame is now published as 'ks-20-173-specialty-court-sentence': K.S.A. 20-173 was read in full on 23 August 2026 and creates specialty courts, the funding advisory committee, the resources fund and the sentence-reduction provision without ever using the word veteran. The judiciary's own list of veterans treatment courts could not be read: kscourts.gov is hard-blocked by Cloudflare from here — the browser reached 'Sorry, you have been blocked', and a re-read after waiting did not clear it. Supreme Court Rule 191 is named in the Judicial Branch's own FY 2026 budget narrative as the rule forming the Specialty Court Committee and was not read either. Only the Sedgwick County build in the 18th Judicial District is documented, from that budget narrative.

    Still needed: Kansas Supreme Court Rule 191 itself, and the Judicial Branch's veterans treatment court page at kscourts.gov/About-the-Courts/Specialty-Courts/Veterans-Treatment-Court, from a network that is not Cloudflare-blocked.

  • A women veterans programme or coordinator

    low confidence it exists · K.S.A. chapter 73, article 12

    Chapter 73's section list was read on 23 August 2026 and several article 12 sections were read in full — 73-1234 (veterans claims assistance programme), 73-1235 (the VCAP advisory board), 73-1236 (annual legislative review), 73-1241 to 73-1243 (the Vietnam war era recognition award), 73-1244 and 73-1245 (the document and disability-proof rules). None of them establishes a women veterans programme or coordinator. kovs.ks.gov remains unreachable on every path tried, so whether the office runs one administratively is unknown.

    Still needed: A readable kovs.ks.gov programme or staff page, or a section of chapter 73 establishing a women veterans post.

  • A veteran route into beginning-farmer or agricultural programmes

    low confidence it exists · To be identified

    No veteran-gated agricultural programme was located in this state on 23 August 2026. The federal work in this region is real — a federally funded veteran farmers project runs across several plains states — but that is federal money passed to nonprofits, not a state benefit, and nothing state-level was read. Recorded as a silence, not an absence.

    Still needed: The state agriculture department's own programme pages, or a chapter of the statutes establishing a beginning farmer programme, read directly for a veteran route.

Kentucky — 9 on the worklist

A first pass over Kentucky statewide law: the $49,100 homestead exemption — a general disability law a totally disabled veteran claims through the VA classification. Geography is complete for all 120 counties; county tax rates and the local layer are not.

  • State veterans cemeteries — what the family is actually charged

    high confidence it exists · KRS 40.315(4); 17 KAR chapter 4

    The eligibility half is now closed. KRS 40.315 was read on 23 August 2026 and is published — the trick was that the id implied by the chapter sequence (21847) 302s to InvalidStatute.aspx, and the statuteRsn in that redirect (56650) is the live id, returning the version effective 1 January 2026 with its new reserve component and National Guard route. What is still missing is money. The section names no charge at all: it requires interment service in accordance with 38 U.S.C. secs. 2404 and 2408 and leaves operating detail to administrative regulations the department MAY promulgate. It has not promulgated any for the cemeteries — the index of 17 KAR chapter 4 was read the same session and holds only 4:030 (burial honor guard) and 4:040 (indigent burial), with 4:010 and 4:020 expired. So the spouse and dependent fee, the plot reservation rules and the pre-need mechanics are published nowhere the legislature carries.

    Still needed: A readable veterans.ky.gov cemeteries page or fee schedule. veterans.ky.gov still returns an edge-level 'Service unavailable / The request is blocked' page on every path including the root, unchanged on 23 August 2026. Failing that, the State Cemeteries Director's office — named with a telephone number inside 17 KAR 4:030 — is the published human route.

  • Utilities — any veteran route into energy assistance or a commission-approved discount

    medium confidence it exists · To be identified

    Searched as a priority on 23 August 2026 and nothing was found to read. The Public Service Commission's mandate for regulated utilities to participate in a winter assistance programme dates from the 1980s and is described in secondary write-ups as keyed to low income, elderly and disabled households — with no veteran limb. The federally funded energy assistance programme here is run through the health and family services cabinet and delivered by community action agencies, and its published priorities are income and the elderly and disabled, again with no veteran route. Nothing was published from any of that because no administering agency page was read directly this session.

    Still needed: The Public Service Commission's own page or order creating any veteran-specific rate treatment, or the cabinet's own energy assistance eligibility page showing a veteran priority — read directly, not from a search shell. If both establish that no veteran route exists, this becomes a published absence rather than a candidate.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Kentucky has 120 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Veteran-owned business certification and procurement preference

    high confidence it exists · KRS chapter 45A (model procurement code)

    The finance and administration cabinet runs a Service-Disabled Veteran-Owned Small Business certification programme and publishes a page for it, and KRS 45A.470 governs purchasing preferences. Neither could be read: finance.ky.gov returns 403 to every request, and the department's own site (veterans.ky.gov) is edge-blocked. What the certification is actually worth in a bid — a percentage, a set-aside, or nothing but a directory listing — is therefore unknown.

    Still needed: The finance cabinet's SDVOSB page or KRS 45A.470 itself, read directly.

  • National Guard Tuition Award — the live lifetime cap

    high confidence it exists · 106 KAR 3:010

    The programme is now published from KRS 164.5161 and 106 KAR 3:010, read 23 August 2026. The regulation sets lifetime caps of $20,000 at KCTCS, $40,000 at private institutions and comprehensive universities and $50,000 at UK or U of L, each increasing five percent annually from the 2016–2017 base year. Nine compounding increases later the live figure is materially higher and is published nowhere in the regulation. The Department of Military Affairs and the Education Office publish it; veterans.ky.gov remains edge-blocked from here.

    Still needed: The Kentucky National Guard Education Office’s own current-year figure, or a readable veterans.ky.gov page.

  • Veterans treatment court dockets and what completion earns

    high confidence it exists · KRS 23A.080 or a Supreme Court rule

    Kentucky runs veterans treatment court dockets and the Court of Justice publishes both a programme page and a participant handbook for them, at kycourts.gov/Court-Programs/Specialty-Courts/Pages/Veterans-Treatment-Court.aspx and the Veterans_Treatment_Court_Participant_Handbook_Interactive.pdf under the same directory. Neither could be read on 23 August 2026: kycourts.gov returns 'Service unavailable' to fetch AND in the browser, on every path. No KRS section establishing a veterans treatment court was located; the specialty docket authority is reported to sit in KRS 23A.080, which was not read. So which circuits run one, the eligibility gate and what graduation earns are all unverified.

    Still needed: The Court of Justice veterans treatment court page and participant handbook, or KRS 23A.080 on apps.legislature.ky.gov, which is the one reachable Kentucky host.

  • Homegrown By Heroes and any state veteran farmer route

    medium confidence it exists · Kentucky Department of Agriculture programme policy

    Homegrown By Heroes began here as a state agriculture department label inside the state's own agricultural marketing programme, and is the origin of the national label of that name. The department's own releases indicate it handed the campaign to a national farmer-veteran nonprofit in 2021, which would make the label a nonprofit certification rather than a state benefit — but kyagr.com and kyproud.com both refused the connection on 23 August 2026, so nothing could be read at source. Whether a veteran farmer here now gets anything from the state, or only from the nonprofit, is unresolved.

    Still needed: The agriculture department's own Homegrown By Heroes and agricultural marketing programme pages, read directly, establishing whether a state route survives and what it costs.

  • What the women veterans programme actually delivers

    medium confidence it exists · KRS 40.600; department administrative regulations

    KRS 40.600 is now published as 'ky-40-600-women-veterans-program' from the statute read in full on 23 August 2026: the programme, the coordinator post, the eligibility test, the six components and the coordinating committee. What is missing is the operating layer — who the coordinator currently is, how a woman veteran reaches them, what the conferences and workshops actually are, and whether any administrative regulation has been promulgated under subsection (7). veterans.ky.gov/Veterans-Programs/Women-Veterans/Pages/default.aspx is edge-blocked from here on every path.

    Still needed: The department's own women veterans page, or any KAR promulgated under KRS 40.600(7).

  • State caregiver stipend, respite or adult day support with a veteran route

    medium confidence it exists · KRS ch. 40 or ch. 205; Cabinet for Health and Family Services regulations

    Not established either way. The whole of KRS ch. 40 was listed on 23 August 2026 and contains no caregiver or respite section — KRS 40.325 is the veterans nursing homes provision and is already published. Any caregiver support would sit with the Cabinet for Health and Family Services rather than the veterans department, and neither veterans.ky.gov nor chfs.ky.gov could be read: veterans.ky.gov remains edge-blocked on every path tried.

    Still needed: The Cabinet for Health and Family Services aging and adult services pages, or 910 KAR read for a veteran-routed caregiver or respite programme.

Louisiana — 11 on the worklist

A first pass over Louisiana statewide law: the 2022 three-tier amendment — full exemption at 100% or unemployability, read from parish assessor guidance. Geography is complete for all 64 parishes; parish tax rates and the local layer are not.

  • The statute behind the Military Family Assistance Fund

    high confidence it exists · La. R.S., title 29

    The fund itself is now published from the administering department's own pages — up to $10,000 on a need-based claim per active-duty order in a twelve-month period, for housing, utilities, vehicle costs, food and clothing, as a fund of last resort. What could not be read is the statute creating it, which would settle whether the $10,000 cap, the eligible expense list and the last-resort rule are statutory or departmental policy that can change without notice. legis.la.gov and www.legis.la.gov both failed DNS resolution at every attempt this session.

    Still needed: The La. R.S. section creating the fund, on the state's own statute server.

  • Military Service Relief Act — lease termination, the 6% interest cap, default judgments

    high confidence it exists · La. R.S. title 29, and La. R.S. 9:3261

    Louisiana has its own servicemember relief legislation supplementing the federal Servicemembers Civil Relief Act, and it is reported to carry the three things this corpus most wants in the consumer and legal class: residential lease termination on qualifying orders, a cap reducing pre-service obligations to six percent interest, and protection against default judgments. Leads point at sections in title 29 for the creditor interest cap and at La. R.S. 9:3261 for the lease-termination right, which would put the tenancy provision in the civil code title rather than in the military title — a distinction worth getting right and impossible to confirm without the text. Not a word of it can be published until the statute is read, and every lead found sits on secondary law-aggregator sites this corpus does not use.

    Still needed: The sections themselves on an official state host. legis.la.gov and www.legis.la.gov are unreachable from here, and this session established that the failure is deeper than DNS: the local resolver returns nothing, a public resolver DOES return an address for the www host, and a TCP connection to that address on port 443 times out. Alternative official routes worth trying from a different network: the state legislature's document endpoints, the Attorney General's consumer pages, or a legal-assistance page published by the state National Guard.

  • Utilities — any veteran route through the Public Service Commission or energy assistance

    low confidence it exists · To be identified

    Searched as a priority on 23 August 2026. The Public Service Commission's own site was read — the home page and the consumer information page — and nothing veteran-specific appears anywhere in either: the consumer material covers complaints, the do-not-call register, household goods moving, records requests and outage links. The state housing corporation runs the federally funded energy assistance programme, and its host did not resolve from here. The only utility help the veterans department itself publishes is the Military Family Assistance Fund, which pays utilities among other essential expenses and is already published in this corpus — so the utilities gap here may genuinely be that the fund IS the route.

    Still needed: The state housing corporation's own energy assistance eligibility page, and any Public Service Commission order creating a veteran rate class. If both establish there is nothing, this becomes a published absence pointing veterans at the Military Family Assistance Fund instead.

  • A burial allowance, headstone-setting reimbursement, or a parish indigent-burial duty

    low confidence it exists · To be identified

    Hunted deliberately on 23 August 2026 and not found. The Department of Veterans Affairs' state benefits page and its cemeteries pages were both read in full this session, and between them they publish exactly two burial things: interment at the five state cemeteries, and the interment fee for a spouse or dependent child pegged to the federal VA plot allowance. There is no state burial allowance, no headstone-setting reimbursement and no funeral-honours stipend anywhere on the department's own pages — the cemeteries page instead puts military honours on the funeral home. A parish-level indigent-burial duty would sit in statute rather than on the department's site, and the statute server is unreachable.

    Still needed: Either the statute creating a parish burial duty, read on an official host, or a positive statement from the department that no state burial allowance exists — which would let this be published as an absence instead.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Louisiana has 64 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Occupational licensure for military-trained applicants and military spouses

    high confidence it exists · La. R.S. 37:3651

    R.S. 37:3651 is reported to require every licensing board to license a military-trained applicant whose military occupational specialty is substantially equivalent to the state's requirements, to license military spouses and dependents by endorsement, to issue temporary practice permits, and to exempt active uniformed services members from initial and renewal licence fees. The state statute server would not resolve at any point this session — both legis.la.gov and www.legis.la.gov failed DNS — so none of it could be read.

    Still needed: R.S. 37:3651 on the state's own statute server, or a licensing board's own military page.

  • National Guard death and disability benefit — the statute behind the figures

    high confidence it exists · La. R.S. 29:26.1

    The disability payment is now published tier B from vetaffairs.la.gov, read 23 August 2026: $100,000 or $50,000 for a Louisiana National Guard member permanently and totally disabled on federal OR STATE active duty on or after 11 September 2001. The department separately describes the $250,000 payable to beneficiaries of members killed in action as a FEDERAL death benefit, which contradicts every secondary account treating both sums as one state programme at La. R.S. 29:26.1. That contradiction can only be resolved from the statute, and the statute cannot be reached: legis.la.gov does not resolve from here, retried on 23 August 2026 with and without the www host and failing both.

    Still needed: La. R.S. 29:26.1 on a readable official Louisiana host — or the department’s own claim form and appropriation guidance.

  • Driver licence and ID fee waiver — the schedule behind the signpost

    medium confidence it exists · To be identified

    The department states on its own state benefits page, read 23 August 2026, that Louisiana veterans 'may also qualify for special discounts or waivers on fees for drivers’ licenses or IDs' with proof of veteran status, and refers enquiries to the Office of Motor Vehicles on (225) 925-6146. It publishes no amount, no eligibility threshold and no form. That is a signpost, and it is published here as one. The Office of Motor Vehicles’ own fee pages were not read this session and legis.la.gov does not resolve, so no statutory basis was found either.

    Still needed: The Office of Motor Vehicles’ own fee schedule showing the veteran discount, or the statute that creates it.

  • The Veterans Court programme — eligibility, districts and what completion earns

    high confidence it exists · La. R.S. 13:5361 to 13:5370

    A statutory Veterans Court programme exists here and its provisions were located by citation on 23 August 2026, but not one word could be read at source. Two independent walls: legis.la.gov and www.legis.la.gov resolve to 184.178.144.11 through a public resolver and then time out on every connection — from fetch, from the browser, and from a curl pinned to that address — and lasc.org, which carries the Supreme Court's drug and specialty courts office material including the specialty court brochure and the count of operational courts, returns a Cloudflare 521 'Web server is down'. The eligibility gate, the guilty-plea requirement, the treatment certification rule and what completion earns are all unverified.

    Still needed: La. R.S. 13:5366 and the surrounding sections on the Legislature's own server, or the Supreme Court's drug and specialty courts office pages at lasc.org, from a network that can reach either host.

  • The veteran-owned business certification, and what it is worth in a bid

    high confidence it exists · To be identified

    The veterans department's own state benefits list, read 23 August 2026, names a business certification open to businesses at least fifty-one percent owned by a veteran, an active-duty member, a reservist or a Gold Star spouse, alongside the small business procurement initiative already published as 'la-veteran-initiative'. The certification's own page was not reached, so the ownership test, the application, the fee if any, the renewal period and what the certification actually buys in a state bid are unread. The entrepreneurship pathway is separately published as 'la-pave-veteran-entrepreneur-pathway'.

    Still needed: The economic development agency's own certification page for the veteran business initiative, giving the eligibility test, the application and the procurement effect.

  • State-funded caregiver, respite, adult day or in-home care with a veteran route

    medium confidence it exists · La. R.S. Title 46; Louisiana Department of Health rules

    Not established either way. The Department of Veterans Affairs state benefits page was read in full on 23 August 2026 and lists nothing on caregiver support, respite, adult day health or in-home care; the veterans homes are the only long-term care it names. The health department, which would run any such programme, is edge-blocked: https://ldh.la.gov/subhome/13 and https://ldh.la.gov/page/veteran-directed-care both returned 403.

    Still needed: A Louisiana Department of Health page on veteran-directed care or the aging and adult services waivers, or the Title 46 provisions behind them.

Maine — 9 on the worklist

A first pass over Maine statewide law: the veteran exemption and its $50,000 adapted-housing tier, read from Maine Revenue Services. Geography is complete for all 16 counties; municipal rates and the local layer are not.

  • The statutory basis for the free VA-claim vital record

    medium confidence it exists · 22 M.R.S. §2764 or §2765

    The waiver itself is now published from the Maine CDC’s own fee page, read 23 August 2026: $15 for a first certified copy, $6 for each additional copy ordered at the same time, and free for one certified copy of any vital record used to determine eligibility for Veterans Administration benefits, with the office stating it has no authority to waive fees otherwise. What could not be established is whether that free copy is a legislative entitlement or an administrative practice. 22 M.R.S. §2761 was fetched and turned out to be registration of live births, not fees; §2764 and §2765 are referenced from it and were not read.

    Still needed: 22 M.R.S. §2764 and §2765 on the Legislature’s own server, or the Maine CDC rule that sets the fee schedule.

  • Cemetery locations, and the discretionary Guard, reserve and ROTC burial route

    high confidence it exists · 37-B M.R.S. §504(4)(B-1); departmental routine technical rules

    37-B M.R.S. §504 is now published in full — burial without charge, the 24-continuous-month rule for post-1980 enlisted and post-1981 officers, headstones and vaults excluded from state expense, the green burial section, and the conviction bars. Two things the statute leaves to rules could not be read: the criteria the department sets under §504(4)(B-1) for admitting Guard, reserve and ROTC members and their spouses or minor children, and the number and location of the cemeteries themselves. The bureau's own cemetery pages were tried at https://www.maine.gov/veterans/cemeteries/index.html and https://www.maine.gov/veterans/cemeteries — both returned 404.

    Still needed: The bureau's own cemetery pages, or the routine technical rules adopted under §504(4)(B-1).

  • Servicemember contract termination and interest-rate protection outside the tenancy chapters

    low confidence it exists · Title 9-A (Consumer Credit Code), Title 10, or Title 33

    The residential tenancy side is now settled and published as an absence: 14 M.R.S. chapters 709, 710 and 710-A were read in full on 23 August 2026 and contain no reference to military service, a servicemember, active duty or deployment. What was NOT searched is everything else a deploying household signs. The full chapter list of Title 10 was read and contains no military consumer chapter — the §1500-series chapters are assistive devices, Indian arts and crafts, guaranteed asset protection waivers, cosmetics, broadband and artificial intelligence, none of them military. Title 9-A, the Maine Consumer Credit Code, was not opened at all, and it is the likeliest home for any interest-rate cap below the federal one.

    Still needed: Title 9-A read for a military interest-rate provision, and a search of Title 10 chapters 202, 205-B and 223-A for a mobile telephone, health club or service contract termination right on orders.

  • Whether VA disability compensation counts as income for HEAP and the LIAP credit

    high confidence it exists · MaineHousing HEAP rule; 10-144 C.M.R. or the MaineHousing rules page

    HEAP and the LIAP electricity credit are now published from MaineHousing's own pages, read 23 August 2026, with the 2026–2027 gross income ceilings and the three LIAP conditions. The single fact that decides most veteran households — whether VA disability compensation is counted in gross household income, and whether it can be reduced by the medical expense deduction the agency mentions — is on neither page. Nor is the size of the LIAP credit published anywhere that could be read; the page describes it only as a credit on the electric bill.

    Still needed: MaineHousing's own HEAP rule or programme manual, or a Community Action Agency's published eligibility guidance, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Maine has 16 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Veteran-owned business preference in state contracting

    low confidence it exists · 5 M.R.S. §1825-B

    5 M.R.S. §1825-B was read in full this session. It carries an in-state bidder preference and a reciprocal preference against states that favour their own — and NO veteran or disabled-veteran business preference in any of its subsections. If a veteran-owned business advantage exists here it is not in the competitive bidding statute, so it would have to be a procurement services policy or a separate certification.

    Still needed: The procurement services division's own policy pages, or a certification programme run outside the bidding statute.

  • A women veterans programme or coordinator

    low confidence it exists · 37-B M.R.S. chapter 7

    Chapter 7 of Title 37-B was read in full as the Revisor's own chapter PDF on 23 August 2026 — every section from the bureau's establishment through §517 — and the word women does not appear in it. There is no statutory women veterans programme, coordinator post or gender-specific service in the chapter that governs the bureau. Recorded as a silence rather than an established absence, because a coordinator can exist administratively without a section.

    Still needed: The bureau's own programme or staff pages, establishing whether a women veterans coordinator exists outside the statute.

  • A veteran route into farm, land-link or agricultural programmes

    low confidence it exists · To be identified

    No veteran-gated agricultural programme was located here on 23 August 2026. Chapter 7 of Title 37-B was read in full and contains no farm or land provision; the only land-adjacent veteran fund in it is the hunting opportunities fund at §516, now published. Recorded as a silence.

    Still needed: The agriculture department's own farm programme pages, or a title of the statutes establishing a beginning farmer or farm link programme, read directly for a veteran route.

  • Whether a disabled-veteran or Purple Heart plate does anything at a turnpike gantry

    medium confidence it exists · Maine Turnpike Authority tariff; 23 M.R.S. ch. 24

    The state ferry side is now settled and published as an absence: the Maine State Ferry Service Tariff No. 10.2 was fetched and parsed in full on 23 August 2026 and contains no veteran, military, disabled-veteran, Purple Heart or Medal of Honor fare. The turnpike is the other half of the question and could not be reached at all. https://www.maineturnpike.com/ and https://www.maineturnpike.com/Tolls-Payment/Toll-Rates.aspx both timed out to fetch and to curl on repeated attempts.

    Still needed: The Maine Turnpike Authority's own toll rate and discount pages, or its tariff, read directly.

Mississippi — 8 on the worklist

A first pass over Mississippi statewide law: the total homestead exemption for service-connected total disability, read from the state Veterans Affairs board. Geography is complete for all 82 counties; county tax rates and the local layer are not.

  • A readable official Mississippi Code, for every record in this state

    high confidence it exists · Miss. Code Ann., throughout

    This is the state’s structural problem rather than one missing programme, and on 23 August 2026 a partial way round it was found. There is still no free official code server: law.msleg.ms.gov and code.msleg.ms.gov do not resolve, and the Mississippi Code of 1972 Annotated is published commercially. But billstatus.ls.state.ms.us IS the Legislature’s own server and it prints, in full, the text of every section a bill amends. Three routes work together there: /documents/<year>/html/<CHAMBER>/<range>/<BILL><stage>.htm gives the section text; /<year>/pdf/history/<CHAMBER>/<BILL>.xml gives the status ('Law', 'Approved by Governor', 'Died In Committee') and the effective date; and /<year>/pdf/code_sections/<title>/<chapter+section>.xml lists every bill in that session that touched a given section. Three sections were recovered this way and published tier A — §35-1-41, §93-5-34 and §85-3-1. The limitation is real: only sections that a bill has actually amended can be recovered, only as at that bill, and a bill that died prints proposed text that never became law.

    Still needed: Any official, free, readable Mississippi Code host — or a working dor.ms.gov and msdh.ms.gov. Failing that, the billstatus route above should be run against §27-19-53, §35-3-9, §35-3-11, §35-3-13, §33-7-405 and §37-108-1 to promote the existing tier B records.

  • A veteran burial allowance, headstone setting, or a county duty to bury an indigent veteran

    medium confidence it exists · Miss. Code §43-31-29; Title 35, chapter 5

    Nothing of the kind could be established on 23 August 2026. The veterans affairs department’s own benefit book was decoded and read cover to cover — its text is served under a +29 character shift that has to be reversed before the Miss. Code citations become legible — and it carries no burial allowance, no headstone or marker setting reimbursement and no funeral stipend of any sort. The only burial content is the two state cemeteries and a funeral honours request the department says it does not have cognizance over. Title 35 chapter 5 may not exist: the Legislature’s code section index was probed for 035-0005-0001 across thirteen sessions from 2010 to 2026 and returned nothing in any of them, while neighbouring sections in the same title returned results freely. The nearest live duty found is a general one, on county boards of supervisors, to decently bury paupers and strangers and to adopt an indigent burial policy — which is not veteran-specific and whose text was not read.

    Still needed: Miss. Code §43-31-29 read from an enacted bill on billstatus.ls.state.ms.us, and confirmation of whether Title 35 chapter 5 exists at all.

  • Any state lease or consumer contract termination right for a servicemember under orders

    low confidence it exists · Miss. Code §89-8-19; Title 33, chapter 1

    Not established either way on 23 August 2026, and it should not be published as an absence until it is. Two deployment-adjacent protections WERE recovered and published this session — §93-5-34 on custody and visitation, and §85-3-1 on exempt property, both read from enacted bills on the Legislature’s own server. The landlord-and-tenant side was not: §89-8-19 sets the length of a periodic tenancy and the notice to terminate it, but no enacted bill printing its current text was located, so whether it carries a military overlay is unread. §33-1-19 on re-employment after reserve duty is named in the department’s benefit book but its text is likewise unread.

    Still needed: An enacted bill on billstatus.ls.state.ms.us printing §89-8-19 and §33-1-19 in full, found through the per-session code section index.

  • Education routes for dependants beyond the POW/MIA scholarship

    medium confidence it exists · Miss. Code Ann. §37-108-1; §37-16-13

    The POW/MIA route is now published from the department’s own benefit book, read 23 August 2026: an eight-semester scholarship without cost at any state-supported college or university for a child of a Mississippi servicemember officially reported as a prisoner of war or missing in action, excluding books, food, supplies, materials and extracurricular dues. What the book does NOT contain is any general scholarship for children of service-connected disabled or deceased veterans, which most neighbouring states operate. It also carries an honorary high school diploma at §37-16-13 for World War II, Korea and Vietnam veterans whose education was interrupted, which is unpublished here. Neither can be taken further without the statutory text.

    Still needed: Miss. Code Ann. §37-108-1 and §37-16-13 read directly, and confirmation of whether a disabled-veteran dependant scholarship exists at all.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Mississippi has 82 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Veteran-owned business certification or contracting preference

    medium confidence it exists · Miss. Code Ann. title 31, chapter 7

    The veterans affairs board's own State Benefits guidebook was read cover to cover this session and contains no veteran-owned business item at all — the nearest thing is a privilege tax exemption that turns on age or disability generally, not on service. Reports describe a small business preference in public purchasing that a veteran-owned firm might reach, but the code is not published on any free official server, so nothing could be verified.

    Still needed: The purchasing and travel office's own procurement manual, or the code chapter on public purchases read from an official source.

  • Which circuit court districts actually run a Veterans Treatment Court

    high confidence it exists · Miss. Code §9-25-1; Administrative Office of Courts certification

    The chapter is now published as 'ms-9-25-1-veterans-treatment-court' from the section brought forward whole in a 2025 bill and read on the Legislature's own server on 23 August 2026. What could not be read is where the courts actually sit. The judiciary's own intervention courts material — including its PDF of the veterans intervention court statutes at courts.ms.gov/trialcourts/interventioncourts/ — is unreachable from this network: every courts.ms.gov path, including the site root, returns the judiciary's own error page reading 'This page cannot be displayed', with a client IP and an event ID, in the browser as well as to fetch. Since the section makes a court discretionary for each circuit judge, the list is the whole practical question.

    Still needed: The judiciary's intervention courts pages or its certified court list, from a network courts.ms.gov will serve; or the Administrative Office of Courts' certification register.

  • A veteran route into agricultural programmes

    low confidence it exists · To be identified

    No veteran-gated agricultural programme was located here on 23 August 2026. The veterans agency's own state benefits list was read in full and contains no farm, land or agricultural item. Recorded as a silence.

    Still needed: The agriculture and commerce department's own programme pages, read directly for a veteran route.

Montana — 9 on the worklist

A first pass over Montana statewide law: the MDV rate reduction, read from the Department of Revenue with the current income bands. Geography is complete for all 56 counties; county tax rates and the local layer are not.

  • Purple Heart and disability licence routes not yet read

    medium confidence it exists · Mont. Code Ann. §87-2-803(9); §87-2-815

    The service-member package is now published: §87-2-817 was read on 23 August 2026 and gives Guard, Reserve and active-duty members back from a contingency operation a complimentary conservation licence and a Class A fishing or Class AAA combination licence for five years, plus half-fee deer and antelope tags for a combat-connected injury; §87-2-802 (VA hospital patients fish without a licence) was read alongside it. Two gaps remain. The disability qualification the combat route borrows sits in §87-2-803(9) and that subsection was not reached — the section text returned by fwp and mca covers the half-price general disability licence and the $10 lifetime blind fishing licence but not subsection (9). And the Purple Heart route reported in earlier rounds was not located in any section read this session.

    Still needed: Mont. Code Ann. §87-2-803(9) in full, and whichever section carries the Purple Heart licence route, both on mca.legmt.gov.

  • Veterans affairs division discretionary financial assistance

    medium confidence it exists · Mont. Code Ann. §10-2-108; §10-2-112

    Two statutory accounts were read and both are funding vehicles rather than benefits. §10-2-108 creates a veterans and surviving spouses account in the state special revenue fund, administered by the veterans’ affairs division, fed by revenue under 16-12-111 and 16-11-119, and says only that it 'must be used to provide services and assistance for all Montana veterans and surviving spouses and dependents'. §10-2-112 does the same for a veterans’ services account fed by licence plate money and gifts. Neither names an eligible expense, an amount, an income test or an application. The division’s own programme pages render only under script: https://dma.mt.gov/MVAD/ returned 404 and https://montanadma.org/montana-veterans-affairs-division returned an empty document body to every fetch.

    Still needed: The veterans affairs division’s own assistance page or application form, read directly — or the administrative rules governing spending from either account.

  • State veterans cemeteries — the interment eligibility RULES, not the practice

    high confidence it exists · ARM title 34, chapter 5, subchapter 1 (Montana State Veterans Cemetery), under Mont. Code Ann. §10-2-602

    Most of this candidate has been discharged. The cemeteries are now published as 'mt-10-2-601-state-veterans-cemeteries' from the statute plus the Montana Veterans Affairs Division's own pages, read 23 August 2026: four operating sites (Fort Harrison, Missoula, Miles City, Columbia Falls), the eligible-veteran test the division states (other than dishonorable discharge, sufficient years of service for the period served, legible discharge documentation), interment of Guard and Reserve non-veterans under the Burial Equity for Guards and Reserves Act, and the published fee schedule of 8 April 2024 with its $800 spouse and dependant opening and closing charge. What is still missing is the RULE text. §10-2-602 requires the board to adopt criteria addressing discharge status and length of service, and those rules are ARM 34.5. rules.mt.gov is now a client-rendered application: /gateway/ruleno.asp?RN=34.5.101 301-redirects to /search and returns an 894-byte shell with an empty body, /rule/34.5.101 and /browse/34.5.101 return the same shell, and the guessed data endpoints /api/search and /api/rule returned S3 AccessDenied. So the length-of-service threshold and the rule-level spouse and dependant test are unverified at source.

    Still needed: ARM 34.5.101 to 34.5.112 in readable form from rules.mt.gov or the Secretary of State, or a Montana Veterans Affairs Division eligibility document that states the length-of-service threshold in terms.

  • Death while on state duty — statutory death benefit payment

    high confidence it exists · Mont. Code Ann. §10-1-1201; §10-1-1202

    The part index at https://mca.legmt.gov/bills/mca/title_0100/chapter_0010/part_0120/sections_index.html was read on 23 August 2026 and names §10-1-1201 'Death while on state duty -- death benefit payment -- certification -- rules' and §10-1-1202 'Statutory appropriation'. The section text itself was not opened, so the amount of the benefit, who certifies it, who receives it and how it interacts with the county interment allowance at §10-2-501 are all unknown. This sits beside the published cemeteries and interment records and is the obvious next burial-adjacent record for Montana.

    Still needed: Mont. Code Ann. §10-1-1201 read in full on mca.legmt.gov.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Montana has 56 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • Veteran-owned business preference in state procurement

    low confidence it exists · Mont. Code Ann. title 18

    The procurement act's preference framework is reciprocal and residency-based rather than ownership-based, and reports state the procurement law grants no preference to small or disadvantaged businesses generally. The state procurement bureau's own preferences page redirected to a host that returned 404 on every attempt, so whether any veteran-specific preference exists could not be confirmed either way.

    Still needed: The state procurement bureau's preferences page, or the preferences part of title 18 read section by section.

  • A women veterans programme or coordinator

    low confidence it exists · Mont. Code Ann. title 10, chapter 2

    Title 10 chapter 2 was walked part by part on 23 August 2026 — the board of veterans' affairs, the veterans' homes, interment, the state cemeteries, the memorial trust, the honor and remember act, the long-term care needs study and the miscellaneous provisions — and no part or section establishes a women veterans programme or coordinator. The women veteran program manager named in public material is a FEDERAL VA post, not a state one, which is exactly the confusion worth resolving. The division's own pages at dma.mt.gov were not read this session.

    Still needed: The veterans affairs division's own pages at dma.mt.gov, establishing whether a state women veterans coordinator exists as distinct from the federal program manager.

  • The rule behind the veteran designation on a licence — fee and documents

    medium confidence it exists · Administrative Rules of Montana, motor vehicle division

    §10-2-1301 is now published as 'mt-10-2-1301-veteran-designation' from the section read on 23 August 2026, but the section deliberately leaves the detail to rule: it requires documentation confirming veteran status without saying what, requires the department to verify the status without saying how, and directs the department to make rules necessary to carry out the provisions. So the two things a veteran actually needs to know before driving to a licensing office — which document to bring, and whether a mid-cycle change is charged as a duplicate — are both unread.

    Still needed: The administrative rule promulgated under §10-2-1301, or the motor vehicle division's own veteran designation page giving the document list and the fee.

  • A veteran route into agricultural or beginning-rancher programmes

    low confidence it exists · To be identified

    No veteran-gated agricultural programme was located here on 23 August 2026. Title 10 chapter 2 contains no farm or ranch provision. Recorded as a silence.

    Still needed: The agriculture department's own programme pages, read directly for a veteran route.

Nebraska — 7 on the worklist

A first pass over Nebraska statewide law: the category 4 homestead exemption, read from the Department of Revenue’s regulations — which cap it at 120% of the county average home value, correcting the no-limit claim in most summaries. Geography is complete for all 93 counties; county tax rates and the local layer are not.

  • Game and Parks permit terms, read from the commission itself

    medium confidence it exists · To be identified

    The permits are now published from the Department of Veterans’ Affairs’ own April 2026 Guide to Veterans’ Benefits, read 23 August 2026: a no-fee lifetime annual small game hunt/fish/fur harvest permit and a no-fee lifetime annual park entry permit at 50% or more service connected or 100% non-service-connected with a VA pension, a $5 small game permit at age 64 and over, and a veteran and active-duty waterfowl season. That is a second-hand account of another agency’s programme. The Game and Parks Commission’s own page — outdoornebraska.gov/permits/veterans-and-military-permits/, where veterans.nebraska.gov/militarypermits redirects — returned HTTP 403 on 23 August 2026, so the current fees, the stamps included and the application form are unverified at source, and neither agency publishes a Neb. Rev. Stat. citation for the permits.

    Still needed: A readable outdoornebraska.gov veterans and military permits page, and the statute or commission regulation behind the permits.

  • Military lease termination and the exemption of VA benefits from execution

    medium confidence it exists · Neb. Rev. Stat. 76-1431 (Uniform Residential Landlord and Tenant Act); 25-1559 and 25-1563.01 (exemptions)

    Attempted on 23 August 2026 and stopped at the network, not at a paywall. Nebraska’s landlord and tenant act and its exemption statutes both live on nebraskalegislature.gov, which resolves to 164.119.161.105 and times out at the TCP level: https://nebraskalegislature.gov/laws/statutes.php?statute=76-1431 and the 25-1559 equivalent both returned curl exit 28 after 20 seconds over IPv4 and HTTP/1.1, and WebFetch returned ECONNREFUSED on the same URL. No Nebraska agency publishes the lease-termination right on a page of its own: the Attorney General’s military and veterans page at https://protectthegoodlife.nebraska.gov/military-and-veterans lists 'terminations of lease' but attributes it to the FEDERAL Servicemembers Civil Relief Act, and the Department of Veterans’ Affairs’ April 2026 guide names no housing or tenancy protection at all. So whether Nebraska adds anything of its own to the federal right is genuinely unknown — an absence must not be published on this evidence, because the silence is the department’s and not the legislature’s.

    Still needed: Neb. Rev. Stat. 76-1431 and 25-1559 / 25-1563.01 on a reachable official host, or a Nebraska agency page that states the state-law position on a servicemember lease termination.

  • Military deployment and custody under the Parenting Act

    medium confidence it exists · Neb. Rev. Stat. 43-2929.01

    Nebraska’s Parenting Act is reported to carry a military deployment provision at 43-2929.01. It could not be read on 23 August 2026: nebraskalegislature.gov refuses every connection from here at the TCP level. The judicial branch is reachable — supremecourt.nebraska.gov redirects to nebraskajudicial.gov, which serves normally — but its self-help section was scanned and mentions no military, servicemember or deployment material, and the Department of Veterans’ Affairs’ Legal and Advocacy Assistance page names only the two veterans treatment courts and the university clinic. Montana’s equivalent protections are published from statute; Nebraska’s cannot be until the section is readable.

    Still needed: Neb. Rev. Stat. 43-2929.01 on a reachable official host, or a Nebraska Judicial Branch self-help page addressing deployment and parenting time.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Nebraska has 93 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • A readable Neb. Rev. Stat., for every record in this state

    high confidence it exists · Neb. Rev. Stat., throughout

    This is the state's structural problem rather than one missing programme, and it got worse this round. nebraskalegislature.gov resolves to 164.119.161.105 through a public resolver and then refuses or times out every connection — to fetch, to the browser (navigation denied), and to a curl pinned to that address. Not one section could be read on 23 August 2026. That is why this state's newest records are tier B on department pages: the veterans preference at 48-225 and 48-226 named by the department itself, the resident disabled veteran contracting preference at 73-107, the county veterans aid fund at 80-401.01, and the veterans homes and cemeteries chapters are all unread.

    Still needed: Any reachable official Neb. Rev. Stat. host. Failing that, the department's own April 2026 benefits guide is the best second-hand source and names the section numbers to chase.

  • A women veterans programme or coordinator

    medium confidence it exists · To be identified

    The department publishes a women veterans symposium under its news and events navigation, read 23 August 2026, which implies an organiser and probably a coordinator. The symposium page itself returns 404 on the path tried, and the statutes are unreachable, so whether there is a standing programme or coordinator post — as opposed to an annual event — could not be established.

    Still needed: The department's own women veterans symposium or programme page, and the statute or executive authority behind any coordinator post.

  • A veteran route into the beginning farmer programmes

    medium confidence it exists · Neb. Rev. Stat. 77-5201 et seq. (Beginning Farmer Tax Credit Act)

    A beginning farmer tax credit act exists in this state's statutes and would be the natural home for a veteran route, but the statute server refused every connection on 23 August 2026 so not a word of it was read. Federally funded veteran farmer work runs in this state through nonprofits, which is not a state benefit. Nothing state-level could be verified either way.

    Still needed: The Beginning Farmer Tax Credit Act sections on the legislature's own server, or the agriculture department's own beginning farmer pages, read for a veteran provision.

New Hampshire — 10 on the worklist

A first pass over New Hampshire statewide law: the town-voted veterans credits under RSA 72, read from town assessing guidance. Geography is complete for all 10 counties; town amounts and the local layer are the story and are unresearched beyond the ranges.

  • Turnpike toll exemption — whether any veteran plate reaches it

    medium confidence it exists · RSA 237:12 (exemption from tolls)

    RSA 237:12 is titled 'Exemption From Tolls' and its opening text, surfaced in search, appears to exempt vehicles bearing plates with the state seal and vehicles with permanent plates. Whether a Purple Heart, Pearl Harbor or disabled veteran plate reaches that exemption — and whether an E-ZPass transponder must be registered in advance for it to work at a gantry — cannot be answered without the section text and the turnpike authority's own plan list.

    Still needed: The section text, or the tolling authority's own page. Tried this session and blocked: https://gc.nh.gov/rsa/html/XX/237/237-12.htm returns a 403 'Web Page Blocked' from the statute host's firewall by pinned curl and hangs the connection on direct fetch, and a browser navigation to that host was denied outright; https://www.dot.nh.gov/navigating-nh/highways-and-toll-roads/turnpike-systems returns 403; https://www.ezpassnh.com/faqs loads to a completely empty body in a browser even after an eight second wait, and returns nothing at all to curl. Three hosts, three different failure modes, no reachable authority.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. New Hampshire has 10 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State certification or procurement preference for veteran-owned business

    medium confidence it exists · RSA 21-I (state procurement) or the veterans agency's business pages

    No veteran-owned business certification or procurement preference has been read for this state. Where one exists elsewhere in this corpus it is worth real contract dollars, and its absence here is unverified rather than established.

    Still needed: The procurement or administrative services agency's own page, or the statute. Every nh.gov host returns 403 to a fetch, but nh.gov and nhveterans.nh.gov DO load in a browser session — that route worked this session and is the one to use. The legislature's statute host (gencourt.state.nh.us) refuses even a browser navigation, so the RSA text itself remains unreachable.

  • What the town relief duty under RSA 165 actually pays

    high confidence it exists · RSA 165:5, RSA 165:16, RSA 165:17

    The duty on the town or city to support a war veteran and dependent family unable to support themselves is now published, from the administering department's own statement of it. What is NOT known is the scale: no dollar figures, no income or asset thresholds, no duration limit, and no answer on whether a peacetime veteran is inside the rule. Those are the facts a veteran actually needs before walking into a town hall.

    Still needed: RSA 165 read verbatim, plus any town welfare guidelines. Tried this session and refused: www.gencourt.state.nh.us/rsa/html/XII/165/165-mrg.htm returned 403 to a fetch, and gencourt.state.nh.us refuses browser navigation outright. A municipal welfare office's own published guidelines would be an acceptable substitute source.

  • Guard tuition waiver — statutory limits and sunset

    high confidence it exists · RSA 110-B:63-c

    The waiver is now published from the veterans department's page, which states the eligibility and the spouse transfer but no credit ceiling, no per-semester limit and no rule for a member whose service ends mid-term. The department also states the transfer authority runs to 1 July 2027, and the underlying educational assistance subdivision is understood to carry its own repeal date, neither of which could be checked.

    Still needed: The RSA text. The legislature's statute server refuses both an automated fetch and a browser navigation: https://gc.nh.gov/rsa/html/VIII/110-B/110-B-63-c.htm returned 403 to a live browser this session.

  • Lease termination by a called-up reservist, Guard member or reassigned service member

    high confidence it exists · RSA 540:11-a

    A state lease-termination section for members of the armed services is understood to sit in the actions-against-tenants chapter, covering a reserve or Guard member called to active duty and an active duty member reassigned out of state, with a notice duty running from the receipt of the call-up. If it exists as described it is the strongest consumer protection available to a service member in this state and nothing on it is published here.

    Still needed: The RSA text, or a state agency page that states it. Every nh.gov host refuses an automated fetch, and the legislature's own servers refuse a live browser navigation as well — a browser attempt at dmavs.nh.gov was denied outright this session. The state veterans department's benefits page, read in a browser at https://www.nhveterans.nh.gov/veterans-services/nh-state-benefits-veterans, does not mention lease termination anywhere.

  • Consumer protections and utility provisions for service members

    low confidence it exists · RSA title XXXI (trade and commerce) or a public utilities commission order

    The state veterans department's benefits page was read in full in a browser this session. It covers tax, education, employment, motor vehicles, parks, bonuses, town relief, the veterans home, the cemetery and public records — and contains not one word about utility discounts, energy assistance, telephone or broadband supplements, contract termination, interest caps or deployed-parent custody. That is a complete silence across two whole categories rather than a gap in one programme.

    Still needed: A public utilities commission order or a state energy assistance page naming veterans, and the consumer protection title of the RSA. The statute host is unreachable by any route tried this session.

  • The statute behind the veterans treatment court and the six veterans tracks

    high confidence it exists · RSA title LI (courts), as amended by the 2024 session

    The state veterans department publishes that six veterans tracks run, that a county residence and county of offence rule applies to them, and that legislation signed in the 2024 session created a veterans treatment court programme. The chapter itself is unread, so the eligibility gates, the exclusions and what completion earns are stated only as the department describes them.

    Still needed: The RSA chapter, read directly. The legislature's statute server at gencourt.state.nh.us returned 403 to a fetch of https://www.gencourt.state.nh.us/rsa/html/L/490-J/490-J-mrg.htm and refused a browser navigation outright this session. Also blocked: the judicial branch treatment court locations page at https://www.courts.nh.gov/our-courts/treatment-courts/treatment-court-locations, which returned 403.

  • A state women veterans coordinator or programme

    medium confidence it exists · Unknown — no departmental page found

    Most states in this corpus have at least a women veterans coordinator post. No women veterans page was found on the state veterans department's own site this session, and the coordinator named in national directories for this state sits at a federal facility.

    Still needed: A women veterans page on nhveterans.nh.gov or dmavs.nh.gov, or an RSA creating the post. Neither was reached this session.

  • A state veteran farmer or veteran-owned business programme

    medium confidence it exists · Unknown — no departmental page found

    The farmers-market voucher schemes that operate for veterans here are run by conservation districts and a charity, not by the state department of agriculture, and are therefore not publishable as state benefits. Whether the state runs anything of its own for veteran farmers or veteran-owned businesses is unread.

    Still needed: The state department of agriculture's own veteran page, or a state procurement rule naming veteran-owned businesses, read directly.

North Dakota — 11 on the worklist

A first pass over North Dakota statewide law: the scaled disabled veteran credit at the new $9,000 ceiling, read from the Tax Commissioner. Geography is complete for all 53 counties; county tax rates and the local layer are not.

  • Veterans preference in public employment

    high confidence it exists · To be identified

    Every mature state in this corpus operates one; the mechanics differ.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. North Dakota has 53 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State certification or procurement preference for veteran-owned business

    medium confidence it exists · N.D.C.C. title 54 (state purchasing) or the veterans department's business pages

    Nothing on veteran-owned business certification or a procurement preference has been read for this state. It may not exist; that is not the same as having looked.

    Still needed: The state procurement office's own page or the statute, read directly.

  • What a resident of the state veterans home actually pays

    medium confidence it exists · N.D.C.C. ch. 37-15 and the home's published rates

    The home's eligibility is published here; its charges are not. The rate formula reportedly turns on a percentage of net income after allowable medical expenses for basic care, with Medicaid available for skilled nursing, and none of that was read.

    Still needed: The home's own rates and payment page. Its host returns 403 to a fetch and renders the page contents only in a live browser.

  • National Guard state tuition assistance

    high confidence it exists · N.D.C.C. title 37, and the Guard's state tuition assistance portal

    The veterans department's state education page links the Guard's state tuition assistance directly, so the programme exists. The portal at sta.ndguard.nd.gov redirects every visitor into a state single sign-on flow at publicauth.nd.gov before showing any programme text, so the percentage covered, the eligible institutions, the service obligation and the deadlines are all unread.

    Still needed: The programme text behind the sign-on wall, or a published Guard education office fact sheet. Read this session and blocked: https://sta.ndguard.nd.gov/ (302 into publicauth.nd.gov), https://ndguard.nd.gov/education-services/ (link only, no detail), https://www.veterans.nd.gov/veteran-education-benefits-state (link only).

  • State-funded behavioural or mental health care for veterans

    low confidence it exists · To be identified

    The veterans department's behavioural and mental health page names ND Cares, ND Hopes, the rural behavioural health network and Guard family support, but describes no state-funded service, no eligibility and no payment. Every substantive link on it points at federal or national programmes. That is silence, not a published absence — the page was read and simply does not answer the question.

    Still needed: A state human services page that states what, if anything, the state pays for. Read this session: https://www.veterans.nd.gov/behavioral-mental-health and https://www.veterans.nd.gov/veterans-and-service-members-health, neither of which names a state-funded service.

  • Lease or contract termination on military orders

    medium confidence it exists · N.D.C.C. title 37 (military) — section not identified

    The whole of chapter 47-16, the state's leasing of real property chapter, was downloaded and read in full this session. The words military, armed forces, active duty and change of station do not appear in it anywhere. That rules out the obvious location but does not rule out a provision in the military title, which was not read. Until it is, whether a service member here has any state lease right beyond the federal Act is unresolved rather than answered.

    Still needed: The military title of the Century Code, read in the same way the leasing chapter was: https://ndlegis.gov/cencode/t47c16.pdf answered a fetch and extracted cleanly, so the equivalent title 37 files should too.

  • Veteran route into utility discounts or energy assistance

    low confidence it exists · A public service commission order, or the state energy assistance programme rules

    No state-mandated or commission-approved veteran utility discount, telephone or broadband supplement, or veteran priority inside the state energy assistance programme has been read for this state. Utilities remain one of the two thinnest categories corpus-wide.

    Still needed: A public service commission order or a human services energy assistance page that names veterans or excludes VA disability compensation from countable income.

  • Phases, programme length and outcome of the veterans treatment court

    high confidence it exists · Court system policy and procedures manual

    The department publishes the court's district, eligibility and team, and that is what is now recorded. The court system publishes a participant brochure and a policy and procedures manual which would give the phases, the length and what completion earns.

    Still needed: https://www.ndcourts.gov/Media/Default/other-courts/veterans-treatment-court/Vet-Court-Brochure.pdf and the VTC policy and procedures manual on the same host. That host returned 403 to every request this session.

  • A statutory women veterans coordinator or programme

    medium confidence it exists · N.D.C.C. title 37 (military)

    The department's own women veterans page describes a registry card and a survey and calls conferences, membership, newsletters and committees ideas in development. Whether a statute requires a coordinator or a programme here was not established.

    Still needed: The Century Code chapter on the department of veterans affairs, read directly from the legislature's compiled PDFs.

  • A state veteran farmer or veteran-owned business programme

    medium confidence it exists · Unknown — no departmental page found

    This state has no business record in the corpus. Nothing veteran-specific was found on a state agriculture or commerce page this session, and the searches returned only national programmes and commercial certifiers.

    Still needed: The state department of agriculture's or commerce department's own page naming veterans, or the Century Code procurement chapter, read directly.

Rhode Island — 15 on the worklist

A first pass over Rhode Island statewide law: the §44-3-4 floor exemptions, read from the statute — with the real money in town ordinances that vary tenfold. Geography is complete for all 5 counties; municipal amounts are the story and are unresearched.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Rhode Island has 5 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State certification or procurement preference for veteran-owned business

    medium confidence it exists · RIGL 37-2 (state purchases) or the business regulation department's pages

    No veteran-owned business certification or set-aside has been read for this state. Where a comparable programme exists elsewhere in this corpus it carries a percentage goal worth pursuing.

    Still needed: The state purchasing or business regulation agency's own page, read directly. The veterans office sits behind a bot wall that DOES clear: navigate to vets.ri.gov in a browser and wait about nine seconds, after which every page on the site reads normally. That route worked this session.

  • Occupational licence fee waiver or expedited licensure for veterans and military spouses

    medium confidence it exists · RIGL title 5 (businesses and professions)

    The veterans office publishes no licensing page, and no licensing agency page was reached this session. Fee waivers and expedited spouse licensure exist in most states in this corpus and would be worth real money here.

    Still needed: The business regulation department or the relevant licensing board's own page, or RIGL title 5. The statute server for this state refuses connections.

  • State emergency financial assistance reaching veterans who have already left service

    medium confidence it exists · RIGL title 30 (military affairs and defense) — section not identified

    The one emergency grant this state publishes is now recorded, and the finding is a negative one worth carrying forward: it runs on being CURRENTLY in good standing with a unit, so a separated veteran cannot use it. Every other financial listing on the veterans office site read this session was a federal programme or a charity. Whether the state itself funds anything for a separated veteran in crisis is unresolved rather than answered.

    Still needed: The veterans office's own housing and financial assistance listings read page by page in a browser, plus RIGL title 30. The statute server refuses connections; the veterans office clears its bot wall after about nine seconds in a browser.

  • Veteran Business Enterprise (VBE) certification

    high confidence it exists · RIGL 37-2, administered by the equity, diversity and inclusion division

    The veterans office links a Veteran Business Enterprise programme run by the state's equity, diversity and inclusion division, so certification exists. The division's host returns 'Access denied' to an automated fetch AND to a live browser navigation, including after a wait, so the ownership test, the procurement goal percentage and the application route are all unread.

    Still needed: The division's own VBE page. Blocked this session at https://dedi.ri.gov/divisions-units/minority-business-enterprise-compliance-office/veteran-business-enterprise-vbe-0 by fetch (403) and by browser navigation (Access denied). Confirmed to exist from https://vets.ri.gov/find-your-benefits/find-your-benefits.

  • The consumer and legal protection layer, in the statute

    high confidence it exists · RIGL 34-27-4 (foreclosure), and RIGL title 30 for lease, contract, interest and custody provisions

    One protection is now published: the foreclosure bar, running to nine months after discharge from active duty, from the veterans office's own page. The statute section behind it was not read, and no lease termination, service contract cancellation, interest cap, default judgment or deployed-parent custody provision has been read for this state at all. Neighbouring states in this round carry statutory provisions on every one of those.

    Still needed: The RIGL text. The statute server refused a connection outright again this session: https://webserver.rilegislature.gov/Statutes/TITLE30/30-25/30-25-14.htm returned ECONNREFUSED. The Secretary of State's rules service DOES answer — https://rules.sos.ri.gov/regulations/Part/180-20-00-1 was read in full this session — so regulations are reachable even though statute is not.

  • Veteran route into utility discounts or fuel assistance

    medium confidence it exists · A public utilities commission tariff, or the state energy assistance programme rules

    The veterans office's full benefits index was read in a browser this session. Under housing and financial assistance it links a community action agency fuel assistance programme, which is a general low-income programme rather than a veteran one. No state-mandated veteran utility discount, telephone or broadband supplement, or veteran priority inside energy assistance appears anywhere on the index.

    Still needed: A public utilities commission tariff or a state energy assistance page that names veterans. The office's own index at https://vets.ri.gov/find-your-benefits/find-your-benefits was read in full and does not carry one.

  • Veterans Memorial Cemetery — what the liner fees actually are

    high confidence it exists · 180-RICR-20-00-1

    The cemetery regulation, read in full this session, sets a grave liner fee and a cremation urn liner fee for a spouse or eligible dependant — but sets each one "equal to the department's cost" for the item rather than at a stated figure. So the mechanism is published and the number is not, and a family planning ahead cannot get a total from the regulation.

    Still needed: The current cost figures from the cemetery administration office. The regulation itself is fully read at https://rules.sos.ri.gov/regulations/Part/180-20-00-1 and states no dollar amount by design.

  • Phases, length and formal outcome of the veterans treatment court

    high confidence it exists · Judiciary programme materials

    The state veterans office publishes the court's location, its eligibility gate of service-connected trauma and its referral route, and that is what is now recorded. The phases, the programme length and what completion formally earns are not on that page.

    Still needed: The judiciary's own veterans court pages and the court brochure. https://www.courts.ri.gov and https://riag.ri.gov/what-we-do/criminal-division/veterans-court both returned 403 to every request this session.

  • A state women veterans coordinator or programme

    medium confidence it exists · Unknown

    The state veterans office is reported to have a women veteran coordinator working alongside the federal medical centre's programme manager, but the page found on the office's own site describes the federal medical centre's programme rather than a state one.

    Still needed: A women veterans page on vets.ri.gov describing a state post and what it does, read directly.

  • A state veteran farmer or agriculture programme

    low confidence it exists · RIGL title 2 (agriculture)

    Nothing veteran-specific was found for agriculture in this state this session; the searches returned only national programmes. The state now has a business record for the veteran business enterprise certification, but nothing agricultural.

    Still needed: The environmental management department's agriculture pages, read directly, or RIGL title 2.

  • Whether the bridge authority exempts or discounts a disabled veteran, Purple Heart or Gold Star plate

    medium confidence it exists · Turnpike and Bridge Authority regulations (Title 855 of the state rules)

    Toll relief for military plates exists in several states and nothing on it has been read here. The authority operates four bridges and a state route, and its toll schedule is the only crossing charge in the state.

    Still needed: The authority's own toll page or its filed regulations, read directly. https://www.ritba.org/ and https://www.ritba.org/tolls both answered HTTP 403 to a fetch on 23 August 2026 and a browser session was held at a Cloudflare challenge that did not clear after nine seconds. The state rules host https://rules.sos.ri.gov/Organizations/agency/855 lists the authority but renders its regulation index behind a further link that was not resolved.

  • Whether any utility protection, discount or arrearage programme has a veteran route

    medium confidence it exists · RIGL tit. 39 (public utilities); Public Utilities Commission rules

    The state veterans office's own benefit finder was read in full on 23 August 2026. The only energy item on it is a community action agency's fuel assistance programme, described in general terms with no veteran priority, no veteran supplement and no veteran route. That is evidence of a thin field rather than proof of absence: the protected-status and arrearage rules sit with the utilities commission and were not read.

    Still needed: The public utilities commission's own termination-of-service and protected-status rules, read directly, and the state energy office's assistance page. The general laws host refused every connection and a browser session to it was denied on 23 August 2026.

  • The statutory text behind the veteran property tax exemption — floors, tiers and the survivor routes

    high confidence it exists · RIGL §§44-3-4, 44-3-4.2 and 44-3-5

    The published record ri-44-3-4-exemptions was demoted to tier B on 23 August 2026 because its only source was a commercial reproduction of the statute. The dollar floors it carries — $1,000 for wartime service, $10,000 at total disability, a further $10,000 with an adapted-housing grant — could not be re-verified against the statutory text, and the state veterans office describes eligibility in terms of WARTIME SERVICE and a discharge other than dishonorable rather than a disability rating, which is wider than the rule this record gates on. Reading the text would settle the floors, the tier structure, the conflict list in §44-3-4.2 and the Gold Star parent route in §44-3-5.

    Still needed: RIGL §§44-3-4, 44-3-4.2 and 44-3-5 read directly. Both official hosts the state itself links to resolve to 198.7.237.37 and refused every attempt on 23 August 2026: http://webserver.rilin.state.ri.us/Statutes/TITLE44/44-3/44-3-4.HTM and https://webserver.rilegislature.gov/Statutes/TITLE44/44-3/44-3-4.htm each timed out on a plain fetch, answered ECONNREFUSED to a direct request, and were denied navigation in a browser session. The state veterans office page at https://vets.ri.gov/i-am-find-your-benefits/world-war-ii-korean-war-veteran/property-tax-exemptions reads fine and is now the cited authority.

  • The exemption amount each city and town actually votes

    high confidence it exists · Municipal ordinances; Division of Municipal Finance exemptions report

    The amount a veteran receives is set by municipal ordinance, not by the statutory floor, and the spread across the state is the single biggest variable in this benefit. Specific town figures previously carried in the record were removed on 23 August 2026 because they came from an unofficial source and could not be re-verified.

    Still needed: The Division of Municipal Finance report listing exemptions by city and town, read directly: https://municipalfinance.ri.gov/sites/g/files/xkgbur546/files/documents/data/exemptions/Veterans-Senior-Exemptions-Report.pdf . The host answers HTTP 403 to a fetch and to a headered request; a browser session clears the challenge and the file returns HTTP 200 as a 1,028,155-byte PDF, but its content streams would not inflate in-page on 23 August 2026. It needs a browser session with working PDF extraction, or the same figures from individual assessor pages.

South Dakota — 12 on the worklist

A first pass over South Dakota statewide law: the $200,000 exemption — raised from the $150,000 summaries still quote — read from the Department of Revenue, plus the separate full paraplegic exemption. Geography is complete for all 66 counties; county tax rates and the local layer are not.

  • State income tax treatment of military retirement

    high confidence it exists · To be identified

    How South Dakota taxes military retirement decides real money and is unread here — published only once the statute or revenue department page is read.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. South Dakota has 66 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State certification or procurement preference for veteran-owned business

    medium confidence it exists · SDCL ch. 5-18A (procurement) or the veterans department's pages

    Nothing on veteran-owned business certification or a procurement goal has been read for this state.

    Still needed: The state procurement office's own page or the statute, read directly.

  • What a resident of the state veterans home actually pays

    medium confidence it exists · SDCL ch. 33A-2 and the home's published rates

    The home publishes its eligibility and its spouse rules and does not publish a rate. Several pages in that section returned an error page this session, and the ones that read direct every cost question to a telephone number.

    Still needed: A published rate schedule from the home, or the statutory authority for its charges, read directly.

  • Verbatim SDCL text for the published education and records records

    high confidence it exists · SDCL 33-6-5 to 33-6-8.1, 13-55-6 to 13-55-9.6, 34-25-54, 33A-2-34

    Four records are published from the veterans department's pages, which quote or cite these sections. The legislature's statute server renders only through client-side scripts and returned a browser compatibility notice rather than statute text to every request, so none of the sections was read verbatim and all four records sit at tier B rather than tier A.

    Still needed: The statute text itself, which would lift the four records to tier A. Blocked this session: https://sdlegislature.gov/Statutes/33-6-7 and https://sdlegislature.gov/Statutes/Codified_Laws/2049090, both of which return only a browser notice.

  • A military lease-termination provision outside the leasing chapter

    low confidence it exists · SDCL title 33 (militia) — section not identified

    The absence now published rests on reading the full section list of chapter 43-32, the state's lease of real property chapter, which contains nothing military. That is the chapter such a provision would normally sit in, but it is not the only chapter it COULD sit in. The militia title has not been read.

    Still needed: The militia title, read the same way. The legislature's API path answers cleanly — https://www.sdlegislature.gov/api/Statutes/43-32.html and https://www.sdlegislature.gov/api/Statutes/25-4B-107.html both returned readable statute text this session, which is a new route for this state and should be used for the rest of the code.

  • Veteran route into utility discounts or energy assistance

    low confidence it exists · A public utilities commission order, or the state energy assistance programme rules

    Nothing on utilities has been read for this state. The department's burial and cemetery pages were read this session and, as expected, say nothing about them; no utilities page has been located at all.

    Still needed: A public utilities commission order or a state energy assistance page that names veterans, or excludes VA disability compensation from countable income.

  • Veterans courts outside the Second Judicial Circuit

    high confidence it exists · Judiciary treatment court programme materials

    The judiciary states that drug, DUI, veterans and mental health courts run across all seven judicial circuits, but only the Second Circuit's veterans court handbook was read this session. The eligibility criteria published here — including residence in Lincoln or Minnehaha County — are that circuit's own.

    Still needed: Each circuit's treatment court page and, where published, its veterans court handbook, read directly from ujs.sd.gov.

  • A state women veterans coordinator or programme

    medium confidence it exists · Unknown — no departmental page found

    No women veterans page was found on the state veterans department's own site this session. The coordinator roles that surfaced sit at the federal health care system rather than at the state department.

    Still needed: A women veterans page on vetaffairs.sd.gov, or an SDCL section creating the post, read directly. Note that https://vetaffairs.sd.gov/benefits/State/State%20Benefits.aspx now returns a coming-soon placeholder.

  • A state veteran farmer or veteran-owned business programme

    medium confidence it exists · SDCL title 5 (state purchasing) or title 38 (agriculture)

    This state has no business record in the corpus. Nothing veteran-specific was found on a state agriculture or purchasing page this session.

    Still needed: The department of agriculture and natural resources' own page naming veterans, or the SDCL purchasing chapter, read directly.

  • Whether energy assistance or weatherisation has a veteran route or a veteran income disregard

    medium confidence it exists · To be identified — Department of Social Services energy assistance programme

    This state has no utilities record at all. The state veterans department's benefits index was read in full on 23 August 2026 and lists eleven benefit pages, none of which touches energy, utilities or weatherisation. Whether VA compensation is counted as income for energy assistance, and whether any veteran priority exists, is unresolved.

    Still needed: The social services department's own energy assistance page and its income rules, read directly. https://dss.sd.gov/economicassistance/energyassistance/ returned an empty body to a fetch on 23 August 2026.

  • State-funded caregiver support, respite or in-home care with a veteran route

    medium confidence it exists · To be identified — Department of Human Services; Dakota at Home

    The state veterans department's benefits index, read in full on 23 August 2026, names no caregiver, respite or in-home care programme. The state veterans home is the only long-term care record in the corpus, and it is residential.

    Still needed: The human services department's own caregiver and in-home services pages, read directly, and confirmation of whether a veteran-directed care programme operates through the state aging network.

Vermont — 15 on the worklist

A first pass over Vermont statewide law: the $10,000-to-$40,000 veterans exemption under 32 V.S.A. §3802(11). Every Vermont state host refuses automated connections, so the statutory text was captured as served by the legacy legislature server via search relay and confirmed against a town's municipal record — the record itself says so. Geography is complete for all 14 counties; town amounts and the local layer are not.

  • What the free permanent licence actually covers, season by season

    medium confidence it exists · 10 V.S.A. (fish and wildlife licences) — section not identified

    The headline benefits are now published: the free permanent hunting, fishing or combination licence at a 60% rating, and the lifetime park day-use passport for $2. What is still unread is which licence types the permanent version actually covers, whether tags, stamps and lottery permits are inside it or charged separately, and whether the passport reaches historic sites or a holder's passengers.

    Still needed: The fish and wildlife department's permanent licence application itself, and the parks fee schedule in full. The legislature's statute server refused connections throughout this session, so no V.S.A. section could be confirmed.

  • Disabled veteran plates and registration

    high confidence it exists · 23 V.S.A. (motor vehicles) — section not identified

    The veterans office confirms a no-charge veteran designation on the licence or ID and refers to plates recognising military service, but publishes no plate list and no fee treatment. Plate fee treatment differs plate-by-plate within a single state, so nothing is assumed here.

    Still needed: A working DMV plates page. Tried this session and returned 404: dmv.vermont.gov/registrations/plates/veteran and dmv.vermont.gov/registration/plates/special-interest-plates. The legislature's statute server refused connections, so 23 V.S.A. could not be read either. Find the DMV's current plates index first.

  • Veterans preference in public employment

    high confidence it exists · To be identified

    Every mature state in this corpus operates one; the mechanics differ.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Vermont has 14 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State certification or procurement preference for veteran-owned business

    medium confidence it exists · The buildings and general services department's procurement pages

    The veterans office lists business development among its transition services but publishes no page on veteran-owned business certification or a procurement preference. Neither was reached this session.

    Still needed: The state procurement agency's own page, read directly.

  • Application fee waiver for military members and spouses seeking a professional licence

    medium confidence it exists · 3 V.S.A. ch. 5 (Office of Professional Regulation fees)

    The regulating office is reported to waive application fees for qualifying military members and spouses on request. No page it publishes states it, and the statute that would carry it could not be read.

    Still needed: 3 V.S.A. 125 or the office's own fee page, read directly. The legislature's statute server refused connections throughout this session.

  • Fee exemption for vital records used in a benefits claim

    medium confidence it exists · Title 18 or title 32 of the Vermont Statutes Annotated

    Certified vital records cost $10 here and a veterans exemption for copies required in the prosecution of a claim is widely described. Neither of the two state offices that publish the fees mentions any exemption, and the legislature's statute server refused the connection outright, so the exemption could not be read from any administering source.

    Still needed: The statute text, or a health department or archives page that states the exemption. Read this session and silent on it: https://sos.vermont.gov/vsara/request/certified-vital-records and https://www.healthvermont.gov/stats/vital-records/order-vital-records. Refused connection: https://legislature.vermont.gov/statutes/section/18/101/05015.

  • Consumer, lease and deployed-parent custody protections

    medium confidence it exists · 9 V.S.A. (commerce and trade), 15 V.S.A. (domestic relations), or 20 V.S.A. (military)

    This is a whole class of benefit with nothing published for this state: residential lease termination on orders, cancellation of service contracts, an interest cap, foreclosure or default judgment protection, and custody protection for a deployed parent. Neighbouring states in this round carry statutory provisions on every one of those. The obstacle is not that the provisions are unlikely — it is that the statute server cannot be reached.

    Still needed: The V.S.A. text. The legislature's statute server refused a connection outright again this session. The Secretary of State's rules service is a possible flanking route for regulations, though not for statute.

  • Veteran route into utility discounts or fuel assistance

    medium confidence it exists · A public utility commission order, or the state fuel assistance programme rules

    The veterans office states that its assistance fund makes a one-time payment for critical needs "such as housing and utilities", which is already published as a separate record. Whether there is any standing utility discount, low-income electric rate route or fuel assistance priority written for veterans is unread.

    Still needed: A public utility commission order or a fuel assistance page that names veterans. The office's own programme pages were read in full this session and mention utilities only through the assistance fund.

  • A veterans treatment court or docket

    high confidence it exists · 13 V.S.A. or judiciary programme materials

    A Vermont Veterans Treatment Court Act was drafted for the legislature in 2018 and eligibility language from it circulates widely. Whether a veterans docket now exists, and where, could not be established.

    Still needed: The judiciary's treatment and specialty dockets page. https://www.vermontjudiciary.org/programs-and-services/treatment-and-specialty-dockets returned 403 to a fetch and Access Denied in a browser this session. The legislature's own statute server at legislature.vermont.gov refused connections outright.

  • A state-funded route to VA medical appointments

    medium confidence it exists · Agency of transportation public transit programme

    The state veterans fund is published as funding veterans transportation services among its grant categories, and a statewide ride-finding resource for veterans is run through the transportation agency's commuter service. Neither was read directly this session.

    Still needed: The Vet Lift VT pages on connectingcommuters.org, which returned 404 at the URL found, and the veterans fund's grant award list showing what transportation it actually funded.

  • The statute text behind every Vermont record

    high confidence it exists · V.S.A.

    No Vermont statute was read this session. Every record added in this batch is therefore tier B on an agency page rather than tier A on the law.

    Still needed: legislature.vermont.gov. A fetch of https://legislature.vermont.gov/statutes/section/20/059/01706 failed with ECONNREFUSED this session. A different route into the V.S.A. is needed.

  • Driver’s licence fee exemption for honorably discharged veterans — the actual terms

    high confidence it exists · 23 V.S.A. § 609

    The Department of Motor Vehicles lists this on its own military page under the heading "Exemption from Driver’s License Fee (23 V.S.A. § 609)" and prints the opening words "No fees shall be charged to an honorably discharged veteran of the U.S. Armed Forces..." before truncating. A fee exemption on a credential every veteran needs is worth more than most of what is published for this state, and it cannot be published on nine words.

    Still needed: The text of 23 V.S.A. § 609. Tried 23 Aug 2026: legislature.vermont.gov refused every request and returned no response at all; dmv.vermont.gov reads but truncates the provision on both /military and /tags/veteran.

  • Vehicle fee, title fee and purchase-and-use tax exemptions for veterans

    high confidence it exists · 23 V.S.A. § 378; 23 V.S.A. § 2002; 32 V.S.A. § 8911

    The Department of Motor Vehicles lists three separate exemptions on its military page — a vehicle fee exemption for an honorably discharged veteran, a title fee exemption for a vehicle acquired with federal financial assistance, and a tax exemption for the same — and truncates all three. Together they could be the largest vehicle-side benefit in this state and none of them can be published from a teaser sentence.

    Still needed: The text of 23 V.S.A. §§ 378 and 2002 and 32 V.S.A. § 8911. Tried 23 Aug 2026: legislature.vermont.gov returned no response; dmv.vermont.gov reads but prints only the opening clause of each.

  • Gold star and next-of-kin plates — the fee, and whether remarriage ends a widow’s eligibility

    medium confidence it exists · 23 V.S.A. plate provisions; Vermont DMV forms VD-157 and VD-149

    The published record sets out the two plates and the exact statutory eligibility language quoted on form VD-157, but the Department says only that "Some license plates require a one-time fee (see description)" and names no figure for either plate. Nor does anything read this session say whether a widow who remarries keeps the plate.

    Still needed: The fee schedule for military plates and the underlying statutory subdivision the VD-157 instructions paraphrase. Tried 23 Aug 2026: form VD-157 was retrieved and its instructions read in full; legislature.vermont.gov returned no response.

Wyoming — 12 on the worklist

A first pass over Wyoming statewide law: the veterans exemption, doubled to $6,000 of assessed value for 2025, read from county assessor guidance. Geography is complete for all 23 counties; county tax rates and the local layer are not.

  • State income tax treatment of military retirement

    high confidence it exists · To be identified

    How Wyoming taxes military retirement decides real money and is unread here — published only once the statute or revenue department page is read.

    Still needed: The statute or the administering agency page, read directly.

  • County and municipal veteran programmes

    high confidence it exists · Local ordinance or authority policy

    The local layer held real money and variation wherever researched. Wyoming has 23 counties and none are researched.

    Still needed: The statute or the administering agency page, read directly.

  • State certification or procurement preference for veteran-owned business

    medium confidence it exists · Wyo. Stat. title 16 (state procurement)

    SHARPENED 23 August 2026: the absence is now PUBLISHED as wy-no-state-veteran-business-programme, from the commission's own transition, employment and business chapter, every item in which is federal. What remains unread is the other side of the question — whether the state purchasing title itself carries a veteran preference the veterans agency does not publicise.

    Still needed: Wyo. Stat. title 16, or the state procurement office's own bidder-preference page, read directly. Neither was reached this session.

  • Current levels of care and fee schedule at the state veterans home

    medium confidence it exists · Wyo. Stat. ch. 9 (Department of Health) and the home's published pages

    The home's admission criteria are published here from the veterans commission's May 2021 handbook, which describes a skilled nursing facility then under construction. What the home now offers, and what it now charges, are unread.

    Still needed: The health department's own veterans home pages. That host returns 403 to every request, in a browser as well as a fetch.

  • Vital record fees for a veteran benefits claim

    low confidence it exists · Wyo. Stat. title 35, chapter 1 (vital statistics)

    The state military department publishes that it holds and supplies discharge documents, which is now recorded, but says nothing about birth, death or marriage certificate fees for a claim. Several states in this corpus waive them and it is unknown whether this one does.

    Still needed: The state vital statistics office's fee schedule, or the statute. Neither was reached this session; the military department's pages read this session are silent on it.

  • A military lease-termination provision outside the residential rental article

    low confidence it exists · Wyo. Stat. title 19 (defense forces) — section not identified

    The absence now published rests on reading the whole compiled title 1 and finding no military term anywhere in the residential rental article. That is where such a provision normally sits. Title 19, the defense forces title, has not been read for a lease or contract provision.

    Still needed: The compiled title 19 PDF, read the same way titles 1 and 20 were this session — both downloaded and extracted cleanly from https://wyoleg.gov/statutes/compress/, which is a working primary-source route for this state.

  • Oregon Trail cemetery — what a family interment actually costs today

    high confidence it exists · Wyo. Stat. 19-14-108, and the cemetery's own schedule

    The statute authorises a family interment fee set to cover actual cost. The cemetery's own burial information document, dated November 2022 and read this session, states flatly that there are no fees at the cemetery. Both statements are now carried in the published record because neither can be dismissed, but a family needs one number, not two positions.

    Still needed: A current fee statement from the cemetery director, or a more recent operating document. Read this session: https://www.wyomilitary.wyo.gov/wp-content/uploads/2022/11/OTSVC-BURIAL-INFO-update.pdf, which is three years old.

  • Veteran route into utility discounts or energy assistance

    low confidence it exists · A public service commission order, or the state energy assistance programme rules

    Nothing on utilities has been read for this state. The military department's pages read in earlier rounds and this session name no utility provision.

    Still needed: A public service commission order or a state energy assistance page that names veterans, or excludes VA disability compensation from countable income.

  • Which nine counties the veterans commission serves with its transport grant

    high confidence it exists · Commission programme materials

    The federal grantee list names the state veterans commission as covering nine counties, without naming them, and names five other grantees county by county. The commission's own current pages read this session do not describe the transport programme at all.

    Still needed: A transportation page on wyomilitary.wyo.gov, or a current commission publication naming the nine counties.

  • A state women veterans coordinator or programme

    medium confidence it exists · Unknown — no state post found

    The commission's benefits booklet has a women veterans section, and every contact in it is a federal health care facility. No state women veterans coordinator or programme appears in it or on the commission's current benefits page.

    Still needed: A women veterans page on wyomilitary.wyo.gov, or a Wyo. Stat. section creating the post. Neither was found this session; the booklet read is dated Spring 2021.

  • Disabled parking placard — the fee, the term and the renewal cycle

    medium confidence it exists · Wyo. Stat. § 31-2-213; Department of Transportation fee schedule

    The published record establishes the medical test, the practitioner list, the second-placard right and the absence of any veteran route, all from the statute. What the subsections read do not carry is a fee or a renewal interval, and a permanent placard that quietly expires is a ticket waiting to happen.

    Still needed: The Department of Transportation placard application and fee schedule. Tried 23 Aug 2026: the compiled Title 31 at wyoleg.gov was retrieved in full and § 31-2-213 read end to end; no departmental placard page was fetched.

  • Whether any veteran route exists into energy assistance or weatherisation

    medium confidence it exists · Wyoming low income energy assistance programme; Wyoming Veterans Commission

    This state has no utilities record at all in the corpus. The honest finding elsewhere is that veteran-specific utility discounts mostly do not exist and that what exists is veteran-routed assistance, so the thing to establish here is whether the state energy assistance programme has any veteran door or priority at all.

    Still needed: The Wyoming low income energy assistance programme eligibility page, and any Wyoming Veterans Commission emergency assistance material. Not reached 23 Aug 2026 — the session’s Wyoming work was spent on the compiled Title 31.

Questions we could not answer at all

These are things we could not verify. We publish them as open questions rather than guessing, because a clean-looking wrong rule is worse than an admitted gap.

Florida

TDIU treatment under §196.081, §196.082 and §320.084
No statute, rule, form, DOR bulletin or Attorney General opinion addresses it. Counties decide it differently in practice. We publish the statutory text and say your county may read it differently — we do not present a reading as an agency position.
"Combat-related" is undefined
§196.082 uses the term and neither the statute nor any implementing rule defines it. The DR-501DV asks the question without defining it either.
Whether a county follows the state on anything
The third pass found Hillsborough County reproducing Fla. Stat. §258.0145 exactly on its own conservation parks — 25% for any veteran, free where there is a service-connected disability. Nothing required it to. We now hold ten local records across five counties and three transit operators, and no two of the transit operators draw the veteran line in the same place. That variation is the finding, and it means county-level coverage cannot be inferred from state law. It has to be read, county by county, and 62 counties are unread.
§196.082 renewal behaviour
Whether every county auto-renews this exemption is unconfirmed. We say so on the record rather than assert one answer.
SB 1602 / ch. 2026-125 "Homes for Veterans" pilot
This is a landlord incentive. Veteran-side eligibility is unspecified, so nothing veteran-facing is published until the enrolled text is read.

Texas

Room rates and individual cost at the Texas State Veterans Homes
The homes are published and a veteran rated 70 percent or higher generally pays nothing. What a veteran below that threshold pays depends on rating, income and VA benefits, and rates are set per home and revised annually. We publish the range and the 70 percent threshold rather than a figure we cannot stand behind for an individual.
State Tuition Assistance award amounts and slot counts
The Texas Military Department programme is appropriated annually and awarded on funding availability and demonstrated financial need. We publish the range the department states and label it illustrative, because it is not an entitlement and the figure moves between legislative sessions.
Veteran toll policy at the smaller regional mobility authorities
We verified and published TxDOT, HCTRA, Fort Bend County, NET RMA and NTTA. The Central Texas and Cameron County authorities hold the same optional power under §372.053 and we have not confirmed what each has done with it.
Which cities extended the parking exemption beyond meters
§681.008(c) lets a city extend the exemption to garages, lots and time-limited bays by ordinance, and does not require it. That is roughly 1,200 separate answers. Our record says meters are statewide and everything else is local, which is true and incomplete.
Veterans by service-connected disability status, per county
County population is now complete from the VA's VetPop2023 model, but VetPop county tables carry age and gender rather than service-connected status. We leave that field null rather than applying a national percentage to a state total.
Which counties have a Veterans Service Officer
Local Gov't Code §434.032 permits a commissioners court to appoint one and does not require it. Many rural counties have none — precisely where a digital tool substitutes for absent capacity rather than supplementing it — and we could not verify a list.
The Licence to Carry fee
The statute sets a reduced $25 fee for a veteran discharged more than 365 days ago; the published DPS fee table shows $0. We cite both rather than picking the one that reads better.
§11.261, the county and city version of the tax ceiling
The third pass published the school tax ceiling under §11.26, which is mandatory statewide. Counties, cities and junior college districts may adopt an equivalent limitation of their own under §11.261, and whether a given taxing unit did is a local decision we do not hold for any of the 254 counties. For a homeowner over 65 this is the difference between one frozen line on the bill and three.

California

Which counties process a claim quickly
The Board of Equalization prescribes claim form BOE-261-G for all 58 county assessors, so there is no form variance to record. Processing time and evidentiary preference do vary, and we have not captured them.
Fee treatment of the valor and award plates
California issues Medal of Honor, Former Prisoner of War, Purple Heart, Legion of Valor and Pearl Harbor Survivor plates and the fee treatment differs between them. We publish the Disabled Veteran plate and its §9105 fee exemption; the others are unresolved, and we publish none of them rather than describe a fee waiver that may not exist.
Local transit and municipal programmes
LA Metro, BART, Muni and the other large authorities between them serve most California veterans. We have published none of them.
Toll enrolment terms outside San Diego
The toll exemption is statutory and statewide, but enrolling is done agency by agency and each sets its own account terms. We hold SANDAG's: a $40 prepaid toll deposit to open an account. What the Bay Area, Orange County and Los Angeles agencies require, and how each treats a veteran travelling as a passenger rather than the driver, is unresearched — and it is the difference between an exemption on paper and one you can use.
Whether the military retirement exclusion survives 2029
The exclusion applies to tax years beginning before 1 January 2030 and then stops unless the Legislature extends it. Bills to raise the cap to $40,000 and extend the window exist and are not law. Anyone planning a long retirement here needs to know the relief has an end date, and we would rather say that plainly than let a figure sit on the page as though it were permanent.
Veterans home rates
Rates are published per home and per level of care, and an individual's cost depends on income and VA benefits. We publish a range rather than a figure we cannot stand behind for one person.

New York

Which MAXIMUM each locality adopted
The second pass closed half of this. We now hold the state's record of exemptions actually granted in each county, which is direct evidence of adoption and is published on every county page. What remains is the ceiling: each jurisdiction selects a maximum from a statutory menu, and granted-amount data does not reveal which one it chose. That last step may only exist in local resolutions rather than in any state dataset.
New York City property tax rates
The five boroughs are absent from our rate table because New York City is a special assessing unit reporting class-based rates rather than the per-municipality rates the other 57 counties use. Roughly 40% of New York's veterans live in the five boroughs, so this is the largest single coverage gap in the state.
New York State Veterans Homes
New York operates five, at Batavia, Montrose, Oxford, St Albans and Stony Brook. Several are run by SUNY rather than by the veterans department, so admission and cost work differently from the state-run models we have published elsewhere.
The Blind Annuity amount
Set by appropriation and adjusted periodically. We publish an approximate figure and say so rather than presenting a stale number as current.
How the veterans exemptions stack with STAR and the property tax credit
Neither is veteran-specific, but both land on the same bill. Publishing one without modelling the others would understate what a veteran actually pays.
How the Restoration of Honor Act is applied in practice
The Act is generous on its face — the standard is "at least as likely as not" — but the Department of Veterans' Services does not publish its determinations, approval rates, or how it weighs the aggravating-circumstances bar that applies to a discharged LGBT veteran. That bar is what decides the marginal case, and we can describe the rule without being able to tell anyone their odds.
No statewide answer for a veteran who cannot pay
Three of the four states in this corpus run a statewide property tax deferral for a homeowner in difficulty. New York runs none. New York City operates Property Tax and Interest Deferral for its own residents, which covers roughly 40% of the state and nobody else — so a veteran in Buffalo or Binghamton facing the identical problem has nothing to apply to. We have not modelled the city programme because it spans five county records and our schema scopes a local benefit to one; that is a limitation on our side, not a reason it should stay unrecorded.
Senior citizens exemption adoption, county by county
We publish the senior exemption as a local option and cannot yet say which localities adopted it. The state dataset our county pages already use for the veterans exemptions covers this one too — we simply have not pulled it. Doing so would give the same evidence-of-adoption treatment to what is often the larger exemption.

Pennsylvania

Recreation and vehicle fee concessions
Pennsylvania issues disabled veteran plates and runs hunting and fishing concessions, and we have not read either against the current fee schedule. The Purple Heart plate in another state turned out to be free only where the holder ALSO qualified on another ground, so we do not assume.
County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 67 counties has been researched for its own programmes. In the states where we HAVE done that research, the local layer held real money and real variation — three transit operators in one state drew the veteran line in three different places. Its absence here is a gap in our research, not an absence of benefits.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not yet researched them here, and we would rather show two verified records than fifteen half-checked ones.

Illinois

Whether the grant is capped in terms or credit hours
The published pages state no limit on the Illinois Veterans' Grant, but an absence of a stated limit is not a confirmed absence of one. Anyone planning a full degree around it should ask ISAC directly, and we would rather say that than imply we checked.
County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 102 counties has been researched for its own programmes. In the states where we HAVE done that research, the local layer held real money and real variation — three transit operators in one state drew the veteran line in three different places. Its absence here is a gap in our research, not an absence of benefits.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not yet researched them here, and we would rather show two verified records than fifteen half-checked ones.

Ohio

The War Orphans award amount
Ohio Rev. Code §5910.032 sets what the scholarship pays at state and at private institutions. The Ohio codes site was unreachable on the verification date, so eligibility is verified and the figure is not. We publish no number rather than an estimated one.
County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 88 counties has been researched for its own programmes. In the states where we HAVE done that research, the local layer held real money and real variation — three transit operators in one state drew the veteran line in three different places. Its absence here is a gap in our research, not an absence of benefits.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not yet researched them here, and we would rather show two verified records than fifteen half-checked ones.

Georgia

Education for children of active-duty veterans
HERO is a Guard and Reserve programme. What Georgia offers the children of disabled or deceased ACTIVE-DUTY veterans is a separate question this pass did not reach, and it is probably the larger population.
County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 159 counties has been researched for its own programmes. In the states where we HAVE done that research, the local layer held real money and real variation — three transit operators in one state drew the veteran line in three different places. Its absence here is a gap in our research, not an absence of benefits.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not yet researched them here, and we would rather show two verified records than fifteen half-checked ones.

North Carolina

How the scholarship differs between its classes
The programme runs in several classes of eligibility with different award terms, and the material we read does not set out how the award differs between them or between public and private institutions. We publish the eligibility and decline to quote an amount that may apply to only one class.
County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 100 counties has been researched for its own programmes. In the states where we HAVE done that research, the local layer held real money and real variation — three transit operators in one state drew the veteran line in three different places. Its absence here is a gap in our research, not an absence of benefits.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not yet researched them here, and we would rather show two verified records than fifteen half-checked ones.

Michigan

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 83 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

New Jersey

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 21 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Virginia

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 133 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Washington

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 39 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Arizona

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 15 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Vehicles, recreation and employment preference
Education is now researched and published. Vehicles, recreation and employment preference are not, and we would rather show three verified records than fifteen half-checked ones.

Tennessee

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 95 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Massachusetts

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 14 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Indiana

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 92 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Missouri

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 115 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Maryland

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 24 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Minnesota

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 87 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Wisconsin

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 72 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Oklahoma

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 77 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

South Carolina

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 46 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

West Virginia

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 55 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Nevada

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 17 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

New Mexico

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 33 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Oregon

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 36 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Utah

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 29 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Alabama

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 67 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Alaska

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 30 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Arkansas

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 75 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Colorado

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 64 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Connecticut

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 8 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Delaware

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 3 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

District of Columbia

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 1 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Hawaii

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 5 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Idaho

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 44 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Iowa

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 99 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Kansas

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 105 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Kentucky

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 120 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Louisiana

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 64 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Maine

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 16 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Mississippi

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 82 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Montana

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 56 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Nebraska

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 93 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

New Hampshire

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 10 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

North Dakota

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 53 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Rhode Island

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 5 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

South Dakota

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 66 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Vermont

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 14 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Wyoming

County tax rates are effective estimates
Rates are EFFECTIVE estimates from the Census ACS 2023 five-year file (aggregate taxes paid divided by aggregate home value, per county) - not the statutory levy tables. They size a saving honestly; the levy table on your own bill governs, and the per-levy statutory breakdown remains unresearched.
The local layer
None of the 23 counties has been researched for its own programmes. Where we HAVE done that research elsewhere, the local layer held real money and real variation.
Education, vehicles, recreation and employment preference
Every mature state in this corpus has records in all four categories. We have not researched them here, and we would rather show two verified records than fifteen half-checked ones.

Found something wrong?

Every record carries a "something look wrong?" control. A flag from a county office, a veterans service officer, or a claimed agency listing goes to the top of the review queue. It is the cheapest true positive we get.